BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P22 (718 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77664-1|CAB01216.2| 900|Caenorhabditis elegans Hypothetical pr... 30 1.4 U80437-17|AAB37628.1| 180|Caenorhabditis elegans Hypothetical p... 29 3.3 >Z77664-1|CAB01216.2| 900|Caenorhabditis elegans Hypothetical protein F53H10.2 protein. Length = 900 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 417 SSLQHINQ*VICGRDHRPSVVKLLTRKDKHILNKVFAFNQLELL-SNCTSPQVNY 578 SS +H+ + G+ HRPS++ + ++ H+ K +++ L N T P + + Sbjct: 43 SSGEHVPEYQASGQQHRPSIMSGQSHQNNHLPTKNYSYEPLRFSPPNVTPPPLQF 97 >U80437-17|AAB37628.1| 180|Caenorhabditis elegans Hypothetical protein C43E11.9 protein. Length = 180 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 36 CVARAPALTFQAQVCKFGMLKKFHYYI 116 C+AR P L+F + KF KKFH I Sbjct: 57 CIAREPLLSFGTCLGKFTKSKKFHLQI 83 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,665,311 Number of Sequences: 27780 Number of extensions: 257945 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -