BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P18 (503 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 24 2.5 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 24 3.4 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 3.4 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 4.5 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 5.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 5.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 5.9 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 23 7.8 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 7.8 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 24.2 bits (50), Expect = 2.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 293 HGQQHPPCAQQHGAS 337 HGQ+H PC +G + Sbjct: 23 HGQEHKPCTTPNGTA 37 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.8 bits (49), Expect = 3.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 19 ALNFHLHLVPVESRARSPDAAVRD 90 +LNF H+ P R R PD +D Sbjct: 1394 SLNFTEHMTPGTERIRLPDTVDQD 1417 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 3.4 Identities = 10/41 (24%), Positives = 15/41 (36%) Frame = +2 Query: 197 LHNLPPHSFSTRXXXXXXXXXXXYHQQVSWTFHGQQHPPCA 319 + N P S R Y + ++ + G HP CA Sbjct: 1621 IQNYPIESEYARYFFSVHPDFDYYERMFNYAYRGNYHPSCA 1661 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 272 QQVSWTFHGQQHPPCAQQH 328 QQ ++H QQHP +Q H Sbjct: 166 QQQPSSYHQQQHPGHSQHH 184 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.0 bits (47), Expect = 5.9 Identities = 13/71 (18%), Positives = 27/71 (38%) Frame = -1 Query: 458 IWLFWRVHSLEISTAIIWFILVTAASTWLLALAYRNTKFQLKHXXXXXXXXXXXXEMSRK 279 I+L R H++ + WF++ + +L + YR + + +K Sbjct: 245 IYLTARKHNIPLPNNPPWFVIFRVSEDDMLDVCYRIMALYKRGKPNAELLEEAVEALKKK 304 Query: 278 LADDKKMSRKE 246 + +K R E Sbjct: 305 YQEQRKKDRPE 315 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 206 DYEATTYSIFYNNALFLTIVILSSFYILRTFTPTVNYI 93 D+ ++ Y I YN L +S Y+ + VNY+ Sbjct: 3113 DHYSSCYPIEYNGLLTTACAGTNSSYMYTPYIRPVNYL 3150 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 206 DYEATTYSIFYNNALFLTIVILSSFYILRTFTPTVNYI 93 D+ ++ Y I YN L +S Y+ + VNY+ Sbjct: 3116 DHYSSCYPIEYNGLLTTACAGTNSSYMYTPYIRPVNYL 3153 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 502 LLSFTGTLLLFQQFQFGCSGGYIHWK 425 LLS +G + +Q + G + YI W+ Sbjct: 109 LLSLSGASVTYQGEEIGMTDVYISWE 134 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 7.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 295 RATASSLRTATRCFNWNLVLR*ARASNQVLAAVTRINQIIAVLI 426 RAT+S L+ + + + A+ S VL TR+ Q I ++ Sbjct: 278 RATSSGLKIGSAVTLMEMEIALAKKSKPVLETETRLYQAIVDML 321 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 519,738 Number of Sequences: 2352 Number of extensions: 10191 Number of successful extensions: 24 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -