BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P17 (576 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.8 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 23 9.4 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 1.8 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -2 Query: 491 PSEPKPTSPARGAPCRSTNEALAETWSQKNQKLSPQVRSTATLPV 357 P +P T+P R + +EAL ++ LS VRS PV Sbjct: 1315 PIKPCQTNPFRTSTPSKEDEALGALGPLHHRLLSSNVRSLGNSPV 1359 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.6 bits (46), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 413 TTSPPEPRSLIGRVRREQERL 475 T + PEP L+ + R+ ERL Sbjct: 77 TLAGPEPHQLLDELERDIERL 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,959 Number of Sequences: 2352 Number of extensions: 9283 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -