BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P15 (535 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe... 26 4.1 SPCC188.06c |srp54||signal recognition particle subunit Srp54|Sc... 25 9.4 >SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 830 Score = 25.8 bits (54), Expect = 4.1 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 268 PNLSF-PQPVAKHLTPAGARSLAGGRHATPTFGAESTGVS 384 P +SF P +++LTP ++SLA +F + S S Sbjct: 189 PTVSFSPASTSENLTPTSSKSLASNTSLVQSFNSASRSSS 228 >SPCC188.06c |srp54||signal recognition particle subunit Srp54|Schizosaccharomyces pombe|chr 3|||Manual Length = 522 Score = 24.6 bits (51), Expect = 9.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 174 GAVLPVALDVHVRGGGA 124 GAV+ LD H +GGGA Sbjct: 243 GAVIITKLDGHAKGGGA 259 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,769,050 Number of Sequences: 5004 Number of extensions: 34314 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -