BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P14 (561 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 27 0.13 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 27 0.13 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 0.91 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 1.2 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 4.9 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 4.9 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 4.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 4.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 4.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 4.9 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 8.5 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/62 (20%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -3 Query: 553 NENIQKKIDKKRKANKERKNSKDETEIRDKKRKGT--DDVRKTEDNKTDQGRKGRGEPAE 380 N+N + + ANK+ N +++ D K+ G +D ++ + + D + G + Sbjct: 439 NQNANNQNADNQNANKQNGNRQNDNRQNDNKQNGNRQNDNKQNGNRQNDNKQNGNRQNGN 498 Query: 379 KR 374 K+ Sbjct: 499 KQ 500 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 27.1 bits (57), Expect = 0.13 Identities = 23/101 (22%), Positives = 43/101 (42%), Gaps = 2/101 (1%) Frame = +3 Query: 6 PLSCMHVLSTPLVGCVMFLFVDIMYFLCIIKKKVRSALLHYILYKFGKFHTPPSAQLA*K 185 P++ + L + GC+MF+F + F+ + +RS L + + H A + K Sbjct: 255 PVAYVKALDVWMAGCMMFVFAALGEFVVVKVLDLRSQLEYDLQTSIMSRHYSTRAIVIEK 314 Query: 186 G--VQSFCFTY*FNEYVQTRCTSSSLLLDCWSCRVFPLSSV 302 G + + TY + + S LL + W +P+ V Sbjct: 315 GQSIWDYDSTY-IPKVKNKKAGSKHLLQNTWLDPEYPMIRV 354 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 0.91 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 472 RDKKRKGTDDVRKTEDNKTDQGRKGRGEPAEKR 374 R +G DD E+N+ ++ +G+ E AEKR Sbjct: 270 RQNDGEGADDRDDDEENEEEEDGRGQSE-AEKR 301 Score = 21.4 bits (43), Expect = 6.4 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -1 Query: 360 SLRSCGPSCKRPAPRTSGVGHLTVGRPCRTSSPAAAMMRYTAS 232 ++ + G + PA +G G T TS+ AAM T + Sbjct: 218 TVTTTGATTTLPAASATGTGPATPSAVVATSNATAAMTTGTTT 260 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -3 Query: 511 NKERKNSKDETEIRDKKRKGTDDVRKTEDNKTD 413 NKE+ N + E + +++K DDV+ +++ D Sbjct: 110 NKEKSNVCLKFEEQKRRKKSLDDVKILRNDRID 142 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQKSYKNEREYREYRETSRERSRDRKE 72 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQKSYKNEREYREYRETSRERSRDRKE 72 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQKSYKNEREYREYRETSRERSRDRKE 72 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQKSYKNEREYREYRETSRERSRDRKE 72 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQNSYKNEREYRKYRETSKERSRDRKE 72 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQNSYKNEREYRKYRETSKERSRDRKE 72 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ ++ R+ R E SR RK+ Sbjct: 39 YSRSREREQNSYKNEREYRKYRETSKERSRDRKE 72 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ + R+ R E SR RK+ Sbjct: 39 YSRSREREQKSYKNENSYRKYRETSKERSRDRKE 72 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 474 YAIRREKEQMMSGKQKITRQIRGGRDEGSRRRKD 373 Y+ RE+EQ + R+ R E SR RK+ Sbjct: 272 YSRSREREQKSYKNENSYRKYRETSKERSRDRKE 305 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 4.9 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +3 Query: 9 LSCMHVLSTPLVGCVMF 59 +SC+ +++T V C++F Sbjct: 522 ISCLGIVATMAVACLLF 538 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 4.9 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +3 Query: 9 LSCMHVLSTPLVGCVMF 59 +SC+ +++T V C++F Sbjct: 612 ISCLGIVATMAVACLLF 628 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/29 (24%), Positives = 16/29 (55%) Frame = +3 Query: 6 PLSCMHVLSTPLVGCVMFLFVDIMYFLCI 92 P+S + + + C +F+F+ +M F + Sbjct: 269 PVSYVKAIDVWMSSCSVFVFLSLMEFAVV 297 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,937 Number of Sequences: 438 Number of extensions: 3478 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -