BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P13 (317 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 31 0.22 At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 29 0.89 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 28 1.2 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 28 1.2 At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N domain-... 27 2.1 At4g31710.1 68417.m04501 glutamate receptor family protein (GLR2... 27 3.6 At4g02460.1 68417.m00333 DNA mismatch repair protein, putative s... 27 3.6 At1g12910.1 68414.m01499 flower pigmentation protein (AN11) cont... 27 3.6 At2g37390.1 68415.m04585 heavy-metal-associated domain-containin... 26 4.8 At1g80660.1 68414.m09465 ATPase 9, plasma membrane-type, putativ... 26 4.8 At5g64750.1 68418.m08142 AP2 domain-containing transcription fac... 26 6.3 At2g33010.1 68415.m04045 ubiquitin-associated (UBA)/TS-N domain-... 26 6.3 At5g66860.1 68418.m08429 expressed protein 25 8.3 At4g01270.1 68417.m00168 zinc finger (C3HC4-type RING finger) fa... 25 8.3 At3g33530.1 68416.m04290 transducin family protein / WD-40 repea... 25 8.3 At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protei... 25 8.3 At1g19770.1 68414.m02471 purine permease-related low similarity ... 25 8.3 At1g08300.1 68414.m00916 expressed protein 25 8.3 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 30.7 bits (66), Expect = 0.22 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = +2 Query: 83 VRSIGQGTVSGITDVAWIRISVIVVAVTRVDLLRSCQSYNEDGEQNEQFREHFEQFSK 256 ++ + G + +TDV W R +++V++ R ++ D E NE EH+ + ++ Sbjct: 407 MQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKND-EGNEAEDEHWHELAR 463 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 28.7 bits (61), Expect = 0.89 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 152 VVAVTRVDLLRSC-QSYNEDGEQNEQFREHFEQFSK 256 ++ V R +L++ C + +NE E E + + +E FSK Sbjct: 385 ILKVIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSK 420 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 28.3 bits (60), Expect = 1.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 189 QDLNRSTLVTATTITDIRIQATSVIPDTVPWPMDRTVA 76 + +N +TLVTA I A +PDT W M T+A Sbjct: 689 ESVNYATLVTARLIIVASHMAGLGLPDTEAWNMIETIA 726 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 28.3 bits (60), Expect = 1.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 189 QDLNRSTLVTATTITDIRIQATSVIPDTVPWPMDRTVA 76 + +N +TLVTA I A +PDT W M T+A Sbjct: 689 ESVNYATLVTARLIIVASHMAGLGLPDTEAWNMIETIA 726 >At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N domain-containing protein low similarity to NUB1 (NEDD8-interacting protein) [Homo sapiens] GI:13383476; contains Pfam profile PF00627: UBA/TS-N domain Length = 562 Score = 27.5 bits (58), Expect = 2.1 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 8/99 (8%) Frame = +2 Query: 20 RKYQLVAVAVAEVV----WRGSIATVRSIGQGTVSGITDVAWIRISVIVVAVTRVDLLRS 187 R+ QLV ++VAE+V RG + G I + + SV T ++ + Sbjct: 412 RQEQLVGISVAELVSMGFERGKATSALEAGGSREDTIQRL--LSASVANPGTTTTSVINA 469 Query: 188 CQSYNEDGEQNEQFREHFEQFSKL----TDDLGHRRVTT 292 S N G ++ F EQ S++ TDD+ +R T+ Sbjct: 470 TSSTNNVGAESSGFGGGAEQDSEMKDETTDDIANRASTS 508 >At4g31710.1 68417.m04501 glutamate receptor family protein (GLR2.4) plant glutamate receptor family, PMID:11379626 Length = 898 Score = 26.6 bits (56), Expect = 3.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 278 GVLDHQSTLKTAQNVRETVHSVRRPRCSSGKTSTDLLWLRLQQLRIYVSRLRR 120 G++ + A N+R +V P + + S DLL L + R++V + R Sbjct: 202 GIMPGLTDALQAINIRIPYRTVISPNATDDEISVDLLKLMTKPTRVFVVHMNR 254 >At4g02460.1 68417.m00333 DNA mismatch repair protein, putative similar to SP|P54278 PMS1 protein homolog 2 (DNA mismatch repair protein PMS2) {Homo sapiens}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF01119: DNA mismatch repair protein, C-terminal domain Length = 923 Score = 26.6 bits (56), Expect = 3.6 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 251 KTAQNVRETVHSVRRPRCSSGKTSTDLLWLRLQQLRIYVSRLRRLSRIQSPG 96 + +Q +R + P S+G L Q LR RL RLSR+QS G Sbjct: 602 RCSQPLRSVATVLDSPAQSTGPKMFSTLEFSFQNLR--TRRLERLSRLQSTG 651 >At1g12910.1 68414.m01499 flower pigmentation protein (AN11) contains 3 WD-40 repeats (PF00400); identical to GB:AAC18912 from [Arabidopsis thaliana] (Genes Dev. 11 (11), 1422-1434 (1997)) Length = 346 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -3 Query: 267 SSVNFENCSKCSRNCSFCSPSSL*LWQDLNRSTLVTATTITDIRI 133 S V ++C ++N FC P + W + + T++T T I Sbjct: 118 SRVELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTI 162 >At2g37390.1 68415.m04585 heavy-metal-associated domain-containing protein contains Pfam PF00403: Heavy-metal-associated domain; similar to copper homeostasis factor (CCH) (ATX1) (GB:U88711) (TIGR_Ath1:At3g56240) [Arabidopsis thaliana] Length = 259 Score = 26.2 bits (55), Expect = 4.8 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 64 ERQHSHRTIHRPGDCIRDNRRSL-DTYIRNCCSRNQSRSVEVLPELQRGRRT 216 + ++S R I R I+D RRS D +I+ S E+ +GRR+ Sbjct: 31 DERNSGRAIDRHNPIIKDGRRSFADDFIKLPTSAEDGEMSNKKLEIYKGRRS 82 >At1g80660.1 68414.m09465 ATPase 9, plasma membrane-type, putative / proton pump 9, putative / proton-exporting ATPase, putative strong similarity to SP|Q42556 ATPase 9, plasma membrane-type (EC 3.6.3.6) (Proton pump 9) {Arabidopsis thaliana}; contains InterPro accession IPR001757: ATPase, E1-E2 type Length = 954 Score = 26.2 bits (55), Expect = 4.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 158 LQQLRIYVSRLRRLSRIQSPGLWIV 84 + Q I+V+R R S ++ PG W++ Sbjct: 769 VSQALIFVTRSRSWSYVERPGFWLI 793 >At5g64750.1 68418.m08142 AP2 domain-containing transcription factor, putative contains similarity to transcription factor Length = 391 Score = 25.8 bits (54), Expect = 6.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 194 SYNEDGEQNEQFREHFEQFSKLTDDL 271 SY+E Q +QF++H +Q L D + Sbjct: 300 SYSEMARQQQQFQQHHQQSLDLYDQM 325 >At2g33010.1 68415.m04045 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 649 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -3 Query: 222 SFCSPSSL*LWQDLNRSTLVTATTITDIRIQATSVIPDTVPWPMDRTV 79 +F P ++ W + T T+T SV P +P+ D+TV Sbjct: 548 TFLDPQAIQGWTSVGHEAAPTTITLTIYLDDGGSVTPVYIPFRSDQTV 595 >At5g66860.1 68418.m08429 expressed protein Length = 249 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 11 RCLRKYQLVAVAVAEVVWRGSIATVRSIGQ 100 RC+ +YQ + E RG A R+IG+ Sbjct: 28 RCIHQYQTIQAIPREATGRGVSARDRTIGR 57 >At4g01270.1 68417.m00168 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 506 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 276 CPRSSVNFENCSKCSRNCSFCSPSSL*LWQDLNRSTLVTATTITDI 139 CP S N NC C + CS P L N++ + + + I Sbjct: 48 CP--STNKRNCPICKQKCSLKDPCRLYFQSSGNQTDSIASDKVVGI 91 >At3g33530.1 68416.m04290 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 11 (SP:Q9BZH6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 3 weak)|2763187|gb|T46504.1|T46504 Length = 1345 Score = 25.4 bits (53), Expect = 8.3 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -1 Query: 191 GKTSTDLLWLRL-QQLRIYVSRLRRLS--RIQSPGL 93 G+TS L WL+L Q +R +++L R S +I SP L Sbjct: 1016 GETSEALFWLQLPQAIRHLMNKLTRRSPQKISSPTL 1051 >At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protein similar to SP|Q05022 rRNA biogenesis protein RRP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00575: S1 RNA binding domain Length = 1838 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 164 TRVDLLRSCQSYNEDGEQNEQFREHFEQFSKLTDDLG 274 T +D + S +ED + N+ + FE+ L+ D+G Sbjct: 1253 TSLDGMSSADHLSEDLKNNDNVCKRFERIEDLSPDMG 1289 >At1g19770.1 68414.m02471 purine permease-related low similarity to purine permease [Arabidopsis thaliana] GI:7620007; contains Pfam profile PF03151: Domain of unknown function, DUF250 Length = 393 Score = 25.4 bits (53), Expect = 8.3 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 32 LVAVAVA-EVVWRGSIATVRSIGQGTVSGITDVAWIRISVIVV 157 +V AV+ +V W G + V S+ + I+ + W +SV+VV Sbjct: 311 MVGQAVSWQVYWVGIVGLVYSVSSVLSNVISVITWPIVSVLVV 353 >At1g08300.1 68414.m00916 expressed protein Length = 509 Score = 25.4 bits (53), Expect = 8.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 185 TSTDLLWLRLQQLRIYVSRLRRLSRIQSPGLWIV 84 TS + L +R+Q LR+YVS ++ R + L IV Sbjct: 285 TSKEKLGVRIQNLRMYVSFIQDAKRQEGEILKIV 318 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,228,839 Number of Sequences: 28952 Number of extensions: 85735 Number of successful extensions: 357 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 340508912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -