BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P11 (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 3.6 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 6.4 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = -1 Query: 665 FFNEFYDSIIASVRLFCFNVNGLPTISNVLRYELYDV 555 FF+ D+ ++ L C+ ++ TI + LR+E+ ++ Sbjct: 295 FFSAGNDTTSITLALTCYELSLNKTIQDRLRHEVTEI 331 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -1 Query: 314 CGIFVLCFRKGMKWKRAILKTH 249 CG+F +C+ + +A L++H Sbjct: 150 CGLFSVCYPRVSAQMKADLRSH 171 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,566 Number of Sequences: 336 Number of extensions: 3483 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -