BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P10 (778 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 3.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 4.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.5 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 7.3 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.7 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.0 bits (47), Expect = 3.2 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +2 Query: 200 KNTSNICTANTTMKHQKYLIASLSTKKKSLNNFLIYSFIYIQKKRYY 340 K S T K +K +I+SLS NN Y++ KK YY Sbjct: 297 KERSRDRTERERSKERK-IISSLSNNYNYNNNNYKYNYNNYNKKLYY 342 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/52 (21%), Positives = 24/52 (46%) Frame = +2 Query: 140 ISDITLISYSFFFKILPFIRKNTSNICTANTTMKHQKYLIASLSTKKKSLNN 295 ++ I++ S + F IL F+++ +KH + + +KK L + Sbjct: 329 LTSISVESNTMFINILKFLKQKYVKNSKLEKVIKHDILRMLIIDLRKKQLKS 380 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 1 SIGAHYAPRGRTRTWNVTSVSNTGLFI 81 S+G+H+ R RT N + + LF+ Sbjct: 379 SMGSHHGQRVMVRTCNGLELRDPSLFV 405 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 254 LIASLSTKKKSLNNFLIYSFIYIQKKRYYIFRFM 355 +I+SLS K NN Y++ KK YY ++ Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNCKKLYYNINYI 114 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 64 NTGLFIYRLSKIYLHK 111 N LFIY LS LH+ Sbjct: 121 NPNLFIYALSVAILHR 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,086 Number of Sequences: 438 Number of extensions: 3760 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -