BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P09 (409 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 26 0.14 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 0.58 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 0.58 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 0.58 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 0.58 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 0.58 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 0.58 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 0.58 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 5.4 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 5.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.1 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 20 9.4 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.2 bits (55), Expect = 0.14 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +2 Query: 239 ALRPEFDHTGIFRNYSGMANLFIRLIQYYNVFN 337 +L +++ + NY+ N + +QYYN+ N Sbjct: 87 SLSNNYNYNNNYNNYNNNYNTNYKKLQYYNIIN 119 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 0.58 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 272 FRNYSGMANLFIRLIQYYNVFN 337 + NY+ N + +QYYN+ N Sbjct: 94 YNNYNNNYNTNYKKLQYYNIIN 115 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.0 bits (42), Expect = 5.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 118 ACIFKKLVLFDTNIL 162 AC+F+KL D N L Sbjct: 57 ACVFQKLHFMDGNTL 71 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.0 bits (42), Expect = 5.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 118 ACIFKKLVLFDTNIL 162 AC+F+KL D N L Sbjct: 57 ACVFQKLHFMDGNTL 71 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 20.6 bits (41), Expect = 7.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 192 ISPANVRSNDILWRREHSDQSLIILG 269 I + +ND W +S++ L ILG Sbjct: 338 IDSGYILNNDGKWHNIYSEKGLNILG 363 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 20.6 bits (41), Expect = 7.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 192 ISPANVRSNDILWRREHSDQSLIILG 269 I + +ND W +S++ L ILG Sbjct: 338 IDSGYILNNDGKWHNIYSEKGLNILG 363 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 20.2 bits (40), Expect = 9.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 242 LRPEFDHTGIFRNYSGMANLFIRLIQY 322 L P+ DH G + S +LF+ L Q+ Sbjct: 539 LGPKHDHQGRPISISKNQHLFVELDQF 565 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,871 Number of Sequences: 438 Number of extensions: 2092 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -