BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P07 (526 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25440.1 68415.m03047 leucine-rich repeat family protein cont... 28 3.3 At3g62270.1 68416.m06996 anion exchange family protein contains ... 28 4.4 >At2g25440.1 68415.m03047 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to NL0E [Lycopersicon esculentum] gi|4235643|gb|AAD13303 Length = 671 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 468 HDDGEVRIHHSPYQ*-KRLKSQYVARRCNH 382 H DG VR H +Q + K+++ RRCNH Sbjct: 37 HFDGLVRCHPHKFQALTQFKNEFDTRRCNH 66 >At3g62270.1 68416.m06996 anion exchange family protein contains similarity to anion exchanger 3, cardiac splice form - Rattus norvegicus, PIR:A42497 Length = 703 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 391 PARDVLRFQTFLLVWRMVNPHLTIVMRSGLTNTSSGER 504 PAR+ L+ FL WR N +V+ GL T+ R Sbjct: 182 PAREDLKLVEFLPSWRFANGMFALVLSFGLLITALRSR 219 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,501,541 Number of Sequences: 28952 Number of extensions: 159195 Number of successful extensions: 295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -