BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P05 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 28 7.6 >SB_13147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -2 Query: 411 DSALKTKQNLFPTLESDYQLYNGIPYKDLPICNIRVSHNNTI 286 ++ + + +L+PT++ ++ IP + PI N +SHN T+ Sbjct: 143 NATVPSTMHLYPTMQLSHRQCIHIPQCNCPIDNASISHNATV 184 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 429 EKIIDLDSALKTKQNLFPTLESDYQLYN 346 +KI + ++ LK +QNL+ + SD LY+ Sbjct: 248 KKIAEAETKLKQQQNLYEAVRSDRNLYS 275 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,809,739 Number of Sequences: 59808 Number of extensions: 317735 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -