BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P03 (635 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g75230.2 68414.m08739 HhH-GPD base excision DNA repair family... 27 7.9 At1g75230.1 68414.m08740 HhH-GPD base excision DNA repair family... 27 7.9 >At1g75230.2 68414.m08739 HhH-GPD base excision DNA repair family protein contains Pfam domain PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 394 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 407 LIRGFLYQLIYKSTGNV*ITGKQLLCFGKMRHVSSNIKRVKPQ 279 LIR LYQ + GN T LC G+ V N+ + PQ Sbjct: 171 LIRSILYQQLAAKAGNSIYTRFVALCGGENGVVPENVLPLTPQ 213 >At1g75230.1 68414.m08740 HhH-GPD base excision DNA repair family protein contains Pfam domain PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 391 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 407 LIRGFLYQLIYKSTGNV*ITGKQLLCFGKMRHVSSNIKRVKPQ 279 LIR LYQ + GN T LC G+ V N+ + PQ Sbjct: 171 LIRSILYQQLAAKAGNSIYTRFVALCGGENGVVPENVLPLTPQ 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,592,848 Number of Sequences: 28952 Number of extensions: 208247 Number of successful extensions: 328 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -