BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P01 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 291 3e-79 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 291 5e-79 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 290 8e-79 SB_56| Best HMM Match : Actin (HMM E-Value=0) 290 8e-79 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 289 1e-78 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 289 1e-78 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 257 7e-69 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_54| Best HMM Match : Actin (HMM E-Value=0) 87 1e-17 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 86 3e-17 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 68 8e-12 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.006 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 36 0.040 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 32 0.49 SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.6 SB_7681| Best HMM Match : Annexin (HMM E-Value=0) 29 4.6 SB_42365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 6.0 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) 28 8.0 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 291 bits (714), Expect = 3e-79 Identities = 134/145 (92%), Positives = 141/145 (97%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 A+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIR Sbjct: 194 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 253 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLYANTV+SGGTTMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLS Sbjct: 254 KDLYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS 313 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWISK+EYDESGP IVHRKCF Sbjct: 314 TFQQMWISKQEYDESGPAIVHRKCF 338 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 291 bits (713), Expect = 5e-79 Identities = 134/145 (92%), Positives = 141/145 (97%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 A+S+S+EKSYELPDGQVITIGNERFRCPEAL QPSFLGMES GIHET YNSIMKCDVDIR Sbjct: 205 ASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIR 264 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLYANTVMSGGTTMYPG+ADRMQKEI+ALAPST+KIKIIAPPERKYSVWIGGSILASLS Sbjct: 265 KDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLS 324 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWISK+EYDESGP IVHRKCF Sbjct: 325 TFQQMWISKQEYDESGPAIVHRKCF 349 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 290 bits (711), Expect = 8e-79 Identities = 133/145 (91%), Positives = 141/145 (97%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 A+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIR Sbjct: 232 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 291 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGSILASLS Sbjct: 292 KDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLS 351 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWISK+EYDESGP IVHRKCF Sbjct: 352 TFQQMWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 290 bits (711), Expect = 8e-79 Identities = 133/145 (91%), Positives = 141/145 (97%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 A+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIR Sbjct: 231 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 290 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGSILASLS Sbjct: 291 KDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLS 350 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWISK+EYDESGP IVHRKCF Sbjct: 351 TFQQMWISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 289 bits (710), Expect = 1e-78 Identities = 133/145 (91%), Positives = 141/145 (97%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 A+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIR Sbjct: 232 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 291 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLYANTV+SGG+TMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLS Sbjct: 292 KDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS 351 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWISK+EYDESGP IVHRKCF Sbjct: 352 TFQQMWISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 289 bits (709), Expect = 1e-78 Identities = 133/145 (91%), Positives = 141/145 (97%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 AAS+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGMES GIHET YNSIMKCDVDIR Sbjct: 231 AASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 290 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLYANTV+SGG+TM+PGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLS Sbjct: 291 KDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS 350 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWISK+EYDESGP IVHRKCF Sbjct: 351 TFQQMWISKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 257 bits (629), Expect = 7e-69 Identities = 116/145 (80%), Positives = 132/145 (91%) Frame = -2 Query: 677 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 498 A S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGME+ GIHE +YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 497 KDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 KDLY+N V+SGG+TM+PGIADRMQKEI LA +++K+K+IAPPERKYSVWIGGSILASLS Sbjct: 65 KDLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLS 124 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 TFQQMWI+KEEY E GP IVHRKCF Sbjct: 125 TFQQMWIAKEEYHEYGPPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 101 bits (241), Expect = 7e-22 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 29/163 (17%) Frame = -2 Query: 671 STSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKD 492 +T L + Y LPDG+V+ + ERF PEALFQP + +E G+ E ++N+I D+D R + Sbjct: 237 TTVLVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSE 296 Query: 491 LYANTVMSGGTTMYPGIADRMQKEITAL---------------------APSTI-----K 390 Y + V+SGG+TMYPG+ R+++EI L P T K Sbjct: 297 FYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQK 356 Query: 389 IKI-IAPP-ERKYSVWIGGSILAS-LSTFQQMWISKEEYDESG 270 KI I P RK+ V++GG++LA + W++++EY+E G Sbjct: 357 FKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 87.0 bits (206), Expect = 1e-17 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -2 Query: 671 STSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKD 492 S E Y LPDGQ I IG+ERFR E LFQPS LG + GIHE+++ SI KCD+D+R + Sbjct: 2278 SDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAE 2337 Query: 491 LYANTVMSG 465 L+ N V+SG Sbjct: 2338 LFHNIVLSG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 85.8 bits (203), Expect = 3e-17 Identities = 48/145 (33%), Positives = 74/145 (51%), Gaps = 17/145 (11%) Frame = -2 Query: 626 ITIGNERFRCPEALFQPSFLGME-SCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMY 450 + + ERF PE F P F + + + E V N I C +D+R+ LY N V+SGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 449 PGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILASLS 318 R+Q++I + P I+ ++I+ ++Y+VW GGS+LAS Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315 Query: 317 TFQQMWISKEEYDESGPGIVHRKCF 243 F + +K +YDE GP I F Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF 340 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 67.7 bits (158), Expect = 8e-12 Identities = 29/85 (34%), Positives = 55/85 (64%), Gaps = 3/85 (3%) Frame = -2 Query: 566 GMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKI 387 G + G+ + V S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P ++++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 386 KII---APPERKYSVWIGGSILASL 321 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 54.0 bits (124), Expect = 1e-07 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 9/104 (8%) Frame = -2 Query: 560 ESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST----- 396 E + + +S++ C +D RK L N V+ GGT M PG R+ +EI L S Sbjct: 54 EEKSLATALLDSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDK 113 Query: 395 --IK-IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKEEYDE 276 IK +K+ PP + W+GG+I SL ++E Y + Sbjct: 114 LFIKTVKMHQPPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = -2 Query: 548 IHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPG 444 I E + +I K D+D+R+ LY+N V+SGG+T++ G Sbjct: 257 IIEVLAFAIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 35.5 bits (78), Expect = 0.040 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = -2 Query: 662 LEKSYELPDGQVITIGNERFRCPEALFQPSFL 567 L K Y LPDGQ+I+IG E E LF+P L Sbjct: 867 LTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 596 PEALFQPSFLGMESCGIHETV 534 PE +FQPS LG+E GI ET+ Sbjct: 3 PEIIFQPSMLGLEQAGITETM 23 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/75 (28%), Positives = 36/75 (48%) Frame = -1 Query: 552 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 373 R P+DR + HH RR H +HR H R++R+ +G+ L+ +D Sbjct: 830 RPPQDRHRRHHHRRRHHN----NKHRKHSREHSRRRHQRKHHKGNDAQETLEEIFED--D 883 Query: 372 PREEVLRMDRWIHPG 328 R+E +D +++ G Sbjct: 884 ARDEKENVDEFVNGG 898 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -1 Query: 576 FLPGYGIVRHP-RDRVQLHHEV-RRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRA 403 F+ G G++ H + Q+ E R + G +HRH R +HH ++ R+ + + A Sbjct: 894 FVNGGGMMEHELQSDSQISQETGARENDPGKKHKHRHRRHHHHRRQHNRKIKKHRRKHSA 953 Query: 402 LDHQ 391 H+ Sbjct: 954 RKHE 957 >SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1916 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 587 EPRDNGTSRYRW*SPDRQEVRXTSRGRWRR 676 E R NG R R+ PD +VR + WRR Sbjct: 711 ERRHNGRDRRRYGQPDSGDVRQSRTASWRR 740 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 334 MDPPIHTEYFLSGGAMILILMVEGARAVISFCILSAIPGYMV-VPPD 471 +DPP+ +Y L+GG ++ ++ FCI G++V PP+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQ---GFVVPTPPE 801 >SB_7681| Best HMM Match : Annexin (HMM E-Value=0) Length = 426 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Frame = -1 Query: 549 HPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDH--R 376 HP ++ HHE R P H H P ++ E P DH++++ Sbjct: 316 HPPEQ---HHEEEERGVHPPGEHHEEEERGAHPPGQDLEEEERGAHPPGQDHEEEERGAH 372 Query: 375 SPREEVLRMDRWIHP 331 P + +R +HP Sbjct: 373 PPEQHHEEEERGVHP 387 >SB_42365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 791 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 569 GRKAGREPRDNGTSRYRW*SPDRQEVRXTSRGRWRR 676 GR +GR+ RD G R W R R + R RW R Sbjct: 604 GRDSGRDGRDTG--RESWRDGARDSGRDSERKRWPR 637 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 482 NTVMSGGTTMYPGIADRMQKEITALAP 402 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/77 (25%), Positives = 29/77 (37%), Gaps = 4/77 (5%) Frame = -1 Query: 552 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYR--RQDAEGDHRPR--ALDHQDQ 385 RH R R + R RH RH H R++ R + R R H+ Sbjct: 23 RHERSRHETRQHERSRHKTSRHESSRHKTSRHERSRHKTSRHETSRHERSRHETRQHERS 82 Query: 384 DHRSPREEVLRMDRWIH 334 H++ R E R ++ H Sbjct: 83 RHKTSRHETSRHEKSRH 99 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = -1 Query: 597 SRGSLPAFLPGYGIVRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGD 418 +R ++P LPG H R R HH ++H ++ HH Q + Sbjct: 930 ARPNMPGTLPGNYPESHKRHRHSHHHH------------YQHYQYNHHHDHQSHQHHDSH 977 Query: 417 HRPRALDHQ 391 H LDH+ Sbjct: 978 HHREVLDHK 986 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 6.0 Identities = 30/89 (33%), Positives = 36/89 (40%), Gaps = 3/89 (3%) Frame = -1 Query: 555 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVP-RYRRQDAEGDHRPRALDHQDQD- 382 V HPR V +H HP V HR +H + RQDA DH + + H QD Sbjct: 606 VVHPRRDV-VHPRQDVVHPRQDVDHHRQDVDHHRQDVDHHRQDA--DHHRQDVVHPRQDV 662 Query: 381 -HRSPREEVLRMDRWIHPGFPVHLPADVD 298 HR + R D H VH D D Sbjct: 663 VHRRQDADHRRQDADHHRQDVVHPRQDAD 691 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = -1 Query: 546 PRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 376 PRDR + E RRR P R+ R + Y PR RR+ R R D R Sbjct: 854 PRDRRRRSPEHRRRREASPPRRDR--KRYDSPPRRRRRSPSPPPRRRRRDSYSPSRR 908 >SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 485 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 366 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNRLTELGIVKEKIIAPPE 84 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/73 (24%), Positives = 27/73 (36%) Frame = -1 Query: 552 RHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRS 373 RH R R + R RH RH H R++ E R+ H+ + H Sbjct: 63 RHERSRHETRQHERSRHKTSRHESSRHKTSRHGRSRHKTSRHETSRHERS-RHETRQHER 121 Query: 372 PREEVLRMDRWIH 334 R + R ++ H Sbjct: 122 SRHKTSRHEKSRH 134 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/67 (23%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = -1 Query: 525 HHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDH--RSPREEVLR 352 HHE R P + H H P ++ E P H++++ P E Sbjct: 154 HHEEEERGVHPPGQHHEEEERGVHPPGQHHEEEERGVHPPGQHHEEEERGVHPPEEHHEE 213 Query: 351 MDRWIHP 331 +R +HP Sbjct: 214 EERGVHP 220 >SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) Length = 647 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = -1 Query: 555 VRHPRDRVQLHHEVRRRHP*GPVRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHR 376 ++HP ++ H + ++ P + HHVP + +A G+ R Q+ D+ Sbjct: 550 IQHPVEKAIQHAQEKKYQP----ELEKKTIKSHHVPGQDKTEARGEERIAVWSTQNGDYY 605 Query: 375 SPREE 361 R+E Sbjct: 606 DQRDE 610 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,952,723 Number of Sequences: 59808 Number of extensions: 423412 Number of successful extensions: 1474 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1452 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -