BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O21 (543 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 25 5.5 SPBC1734.08 |hse1||STAM like protein Hse1|Schizosaccharomyces po... 25 7.2 SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 25 7.2 SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Sch... 25 7.2 SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 25 9.5 SPBC19C2.01 |cdc28|prp8|ATP-dependent RNA helicase Cdc28 |Schizo... 25 9.5 SPBC2D10.08c |||mitochondrial ribosomal protein subunit Yml6|Sch... 25 9.5 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.4 bits (53), Expect = 5.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 186 ESPLPISQPSTGKLIEILNEDPNVHYMD 103 + P P+SQPS +L + L E H D Sbjct: 5 DPPAPLSQPSASRLQKYLLESAEKHAYD 32 >SPBC1734.08 |hse1||STAM like protein Hse1|Schizosaccharomyces pombe|chr 2|||Manual Length = 373 Score = 25.0 bits (52), Expect = 7.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 141 EILNEDPNVHYMDGICE 91 EI+ +DPN+ M ICE Sbjct: 120 EIMKKDPNMSLMQDICE 136 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 25.0 bits (52), Expect = 7.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 520 VPI*PRLQHSSHTRCYKKY*IKMSVYIGGFICALVLAALVIVWIAYC 380 VPI + H++C++KY G + L+ L+I + YC Sbjct: 705 VPIPKDVDEKGHSKCHRKY---------GHVIELICTLLLIFVVIYC 742 >SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1108 Score = 25.0 bits (52), Expect = 7.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 289 LALERTDSSYAVCPILCIEGFLTSHVPL 372 L + ++D ++CP+LC L + PL Sbjct: 717 LHVNKSDEIRSICPLLCERANLPKNTPL 744 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 24.6 bits (51), Expect = 9.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 487 HTRCYKKY*IKMSVYIGGFICALV-LAALVIVWIAYCMFIRE 365 H R Y ++SV++ F C + L +I+W +YC F ++ Sbjct: 985 HYRSYVHGNSRISVFLESFSCPVPGLEEKIIMW-SYCKFCKK 1025 >SPBC19C2.01 |cdc28|prp8|ATP-dependent RNA helicase Cdc28 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1055 Score = 24.6 bits (51), Expect = 9.5 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -3 Query: 394 WIAYCMFIRERAKSENLQYTISDIQHRNYLFSQEQETPVKEKKLTAGIFVMPSRHKQTED 215 ++ Y R R + L ++ S E P+K K +TAG F +R ++ D Sbjct: 921 FLQYKSLCRARDVRDQLANLCERVEIELVTNSSESLDPIK-KAITAGYFSNAARLDRSGD 979 Query: 214 DYR 206 YR Sbjct: 980 SYR 982 >SPBC2D10.08c |||mitochondrial ribosomal protein subunit Yml6|Schizosaccharomyces pombe|chr 2|||Manual Length = 261 Score = 24.6 bits (51), Expect = 9.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 186 ESPLPISQPSTGKLIEILNE 127 E+P+ +SQP T L+E+L + Sbjct: 132 ENPINLSQPKTRILLEVLKQ 151 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,258,624 Number of Sequences: 5004 Number of extensions: 45413 Number of successful extensions: 115 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -