BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O21 (543 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06930.1 68418.m00783 expressed protein 29 2.7 At2g45940.1 68415.m05712 hypothetical protein contains Pfam prof... 29 2.7 At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR ... 28 3.5 At5g18950.1 68418.m02251 pentatricopeptide (PPR) repeat-containi... 28 3.5 >At5g06930.1 68418.m00783 expressed protein Length = 657 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -1 Query: 219 RTITATDRIXPESPLPISQPSTGKLIEILNEDPNVHYMDGICEGSX*NGPSQRC 58 R + AT P S + ++ +TG + E+ NVHYMD E S +G C Sbjct: 49 RVLDATTASEPSS-VAVTDSTTGSESSEVYENVNVHYMDDANEKSRTDGNLVGC 101 >At2g45940.1 68415.m05712 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 399 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 409 RPIQERI*NHRYKHSFLFNIFYNSVCETSAANEVILEPSAGRIHL 543 RP Q R NHR+ + LF+ F + S ++ PS+G HL Sbjct: 173 RPGQHRKGNHRFSSTELFDYFEQANLMYSKRDQRFYMPSSGGHHL 217 >At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 888 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 406 LVIVWIAYCMFIRERAKSENLQYTISDIQHRNYLFSQEQETPVK 275 LV WI R + K+EN Y I I R+ L +E + VK Sbjct: 427 LVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVK 470 >At5g18950.1 68418.m02251 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 483 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 479 ACVRRVLQTRLYWNHRPAEFI 541 AC+ VL T + WNH P+ +I Sbjct: 265 ACMSEVLHTMIAWNHFPSMYI 285 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,774,600 Number of Sequences: 28952 Number of extensions: 234150 Number of successful extensions: 549 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -