BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O19 (465 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 27 6.6 Z83122-1|CAB05597.1| 293|Caenorhabditis elegans Hypothetical pr... 27 8.8 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 145 HRGRRTSTVREPQEPHFRYRRSSIQQIPGLFCHQKFQSQSRNPQGRY 285 HR R S + + R R S + P ++ S+SR+P+ RY Sbjct: 3 HRSRSNSRSQSRSRENSRGRSRSASKSPVYHRRERESSRSRSPRARY 49 >Z83122-1|CAB05597.1| 293|Caenorhabditis elegans Hypothetical protein R11A5.2 protein. Length = 293 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 88 LRRDGNHFRQRCTSSRGPFHRGRRTSTVREPQEPHFRYRRSSI 216 LRR+ +H ++C S R + + + V E E + Y S + Sbjct: 87 LRRENSHLHEQCESQRERIRKLEQRNDVLETSERNKEYLASDL 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,824,292 Number of Sequences: 27780 Number of extensions: 178164 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 829055604 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -