SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_pT_O14
         (616 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81124-6|CAB03375.1|  335|Caenorhabditis elegans Hypothetical pr...    27   8.1  

>Z81124-6|CAB03375.1|  335|Caenorhabditis elegans Hypothetical
           protein T21B4.8 protein.
          Length = 335

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 14/54 (25%), Positives = 30/54 (55%)
 Frame = +1

Query: 28  ICXKIQMLILSNALFVPVLLNXVINXCPAIMLAVNRTAKVPGRIIFLMVSIITI 189
           +  +  ++++ NA  +  L+    N   +I+L   +  KVP R++F+ V++I I
Sbjct: 102 VVIQFYIILIGNAGNLFFLIMLFENRSSSIILNRLKIDKVPSRVVFICVNVIGI 155


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,176,003
Number of Sequences: 27780
Number of extensions: 140513
Number of successful extensions: 290
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 290
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1332243108
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -