BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O13 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 1.3 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 5.1 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = +2 Query: 74 LENYMENYMQYKIMSSIK*IRMKPNCLPSKFDCRADRKRKFTHSE 208 ++ YM Q + + M+P C+ + C RK K E Sbjct: 232 IDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKE 276 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 280 LIFSRLFNFLDNSESLPFHKCRPRF 206 LIF +FLDN +++ + K F Sbjct: 225 LIFFATLDFLDNVDTIMYEKTNVTF 249 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,724 Number of Sequences: 336 Number of extensions: 3124 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -