BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O13 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0398 - 28644632-28644889,28644997-28645032,28645101-286453... 28 7.5 >02_05_0398 - 28644632-28644889,28644997-28645032,28645101-28645364, 28645439-28645522,28645718-28645798,28645888-28645965, 28646571-28646672,28646754-28646849,28646955-28647161, 28647246-28647493,28647577-28647773,28647997-28648112 Length = 588 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 505 LTYFNSEGKHCDETCTPKCX*DXLRCVIHQPALGQR 612 +T+ G+ DE C+ K D + C+ P+L R Sbjct: 304 ITHTKRNGEPLDEYCSDKIELDPMNCINQAPSLSSR 339 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,900,031 Number of Sequences: 37544 Number of extensions: 287949 Number of successful extensions: 473 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -