BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O13 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 26 0.36 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.5 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 4.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.8 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 25.8 bits (54), Expect = 0.36 Identities = 11/45 (24%), Positives = 19/45 (42%) Frame = +2 Query: 74 LENYMENYMQYKIMSSIK*IRMKPNCLPSKFDCRADRKRKFTHSE 208 ++ YM Q + + M+P C+ ++ C RK K E Sbjct: 28 IDMYMRRKCQECRLKKCLTVGMRPECMVPEYQCAVKRKEKKAQKE 72 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/45 (22%), Positives = 19/45 (42%) Frame = +2 Query: 74 LENYMENYMQYKIMSSIK*IRMKPNCLPSKFDCRADRKRKFTHSE 208 ++ YM Q + + M+P C+ ++ C RK + E Sbjct: 231 IDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEEKAQKE 275 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 594 TSTRPAWW 617 TS RPAWW Sbjct: 23 TSHRPAWW 30 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 366 SNNNIRKNENS*LVSGSSQNG 428 SNNN N N+ +G++ NG Sbjct: 238 SNNNNNNNNNNNNNNGANDNG 258 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,633 Number of Sequences: 438 Number of extensions: 3774 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -