BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O12 (496 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. 24 3.3 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 4.3 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 4.3 >AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. Length = 395 Score = 23.8 bits (49), Expect = 3.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 307 ELPDDMEREILKQFIKSKYDDLRELNDAANETAIASAVNVYIKK 176 E PD +E+ + K + E+N+ E A A+A V +K+ Sbjct: 303 EFPDLLEQNEPMKVSKVVHKAFIEVNEEGTEAAAATAAVVRVKR 346 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 4.3 Identities = 11/63 (17%), Positives = 25/63 (39%) Frame = -1 Query: 394 DPDTCCLHPNDLVNEHNLALEQALKLFHPELPDDMEREILKQFIKSKYDDLRELNDAANE 215 D +C + D +N + ++ L H + D++ + + KY D + + E Sbjct: 106 DLQSCAVFARDRINPYLFNYALSVALLHRKDTHDLDLPTIIEVFPDKYVDSKVFSQIREE 165 Query: 214 TAI 206 + Sbjct: 166 ATV 168 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 4.3 Identities = 11/63 (17%), Positives = 25/63 (39%) Frame = -1 Query: 394 DPDTCCLHPNDLVNEHNLALEQALKLFHPELPDDMEREILKQFIKSKYDDLRELNDAANE 215 D +C + D +N + ++ L H + D++ + + KY D + + E Sbjct: 106 DLQSCAVFARDRINPYLFNYALSVALLHRKDTHDLDLPTIIEVFPDKYVDSKVFSQIREE 165 Query: 214 TAI 206 + Sbjct: 166 ATV 168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 458,883 Number of Sequences: 2352 Number of extensions: 7627 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -