BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O05 (689 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0836 - 25249491-25249511,25249883-25250050,25250721-252509... 30 2.0 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 30 2.0 >06_03_0836 - 25249491-25249511,25249883-25250050,25250721-25250920, 25251000-25251324,25251981-25252045,25252231-25252552, 25252650-25252730 Length = 393 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -1 Query: 347 GQVTFLSPHDRSEGDYGVFRFD-SYSFSNDTFHNVLNGCTKTW 222 G FL+ HD SEG+ +FR++ + F+ + F + NGC K + Sbjct: 204 GWAPFLAAHDLSEGNILLFRYEGNMVFTVEVF--LQNGCLKEY 244 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 275 NMSQIGIHHNLLHCGHAAIGMLLGRP 352 N Q+ IHH+ L CG+A I + +P Sbjct: 326 NSKQVSIHHSNLACGNALINSIKAKP 351 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,069,209 Number of Sequences: 37544 Number of extensions: 316103 Number of successful extensions: 646 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -