BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O05 (689 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8818| Best HMM Match : I-set (HMM E-Value=0) 28 6.2 SB_3514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_8818| Best HMM Match : I-set (HMM E-Value=0) Length = 2787 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 143 VVPEGNLYY-IIYIAFA*DSGI 81 ++P+GN+YY IIY A DSGI Sbjct: 1884 IIPKGNMYYLIIYKASLNDSGI 1905 >SB_3514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 28.3 bits (60), Expect = 6.2 Identities = 22/70 (31%), Positives = 33/70 (47%) Frame = +1 Query: 439 YIHQVSSISAIQCKYRNTKPSKMTQHLILDGTGRSAANDF*HFYKRRLASASVMIPRQTT 618 YIH V SI A + + + L L GT R +F HF++ A ++ + T Sbjct: 168 YIHGVFSICADPRAFHE---HNLVKELKL-GTSRFPEQNFDHFFQYSTAVLALCVSGYTH 223 Query: 619 XSNVTRFLIN 648 S +TR L+N Sbjct: 224 ASFLTRPLVN 233 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,062,843 Number of Sequences: 59808 Number of extensions: 384145 Number of successful extensions: 735 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -