BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O05 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.6 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.4 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 552 RLLTFLQATARVGFGDDTAPDDVLEC 629 RL T LQAT G + P DV EC Sbjct: 131 RLNTRLQATLNCGLRLEKFPFDVQEC 156 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 26 SPAAAMFQSWPSQNSFSHQCLNLKQMLYILYST 124 SP A + WP + C ++ Y++YS+ Sbjct: 169 SPPLAGWNDWPEELEPGTPCQLTRRQGYVIYSS 201 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 26 SPAAAMFQSWPSQNSFSHQCLNLKQMLYILYST 124 SP A + WP + C ++ Y++YS+ Sbjct: 169 SPPLAGWNDWPEELEPGTPCQLTRRQGYVIYSS 201 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 26 SPAAAMFQSWPSQNSFSHQCLNLKQMLYILYST 124 SP A + WP + C ++ Y++YS+ Sbjct: 169 SPPLAGWNDWPEELEPGTPCQLTRRQGYVIYSS 201 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 319 SCGDRNVTWPTRL 357 S + N+TWP RL Sbjct: 389 SVNESNITWPGRL 401 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,720 Number of Sequences: 438 Number of extensions: 3757 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -