BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O03 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein su... 27 3.1 SPCC1259.09c |||pyruvate dehydrogenase protein x component|Schiz... 25 9.3 >SPBC211.01 |rsm10|SPBC23E6.11|mitochondrial ribosomal protein subunit S10|Schizosaccharomyces pombe|chr 2|||Manual Length = 224 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 634 HKSAAEQWLRITGLHLIPLGEIGTANLSIPFAFFRR 527 HKS+ E + RIT LI L + L F++ R+ Sbjct: 117 HKSSQENFERITHSRLIQLYSVNPVTLETFFSYLRK 152 >SPCC1259.09c |||pyruvate dehydrogenase protein x component|Schizosaccharomyces pombe|chr 3|||Manual Length = 456 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 223 LIKFEAFQCSKSCDCYRSIKGHKNYFH 303 ++K QC K+ C S+ + YFH Sbjct: 1 MLKHYIHQCVKASSCKHSLSVKQRYFH 27 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,524,562 Number of Sequences: 5004 Number of extensions: 48030 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -