BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O03 (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110484-14|CAB54405.1| 127|Caenorhabditis elegans Hypothetical... 28 6.5 AF106577-3|AAC78183.1| 399|Caenorhabditis elegans Hypothetical ... 28 6.5 >AL110484-14|CAB54405.1| 127|Caenorhabditis elegans Hypothetical protein Y38E10A.14 protein. Length = 127 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = -1 Query: 610 LRITGLHLIPLGEIGTANLSIPFAFFRRYLNPHSSFSL 497 +++T L+L P G+ +PF+ + ++ HS+F++ Sbjct: 73 IKLTYLYLFPSCGAGSVRELVPFSSYHSFIVTHSTFNI 110 >AF106577-3|AAC78183.1| 399|Caenorhabditis elegans Hypothetical protein F46F5.1 protein. Length = 399 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 503 ERGVRVEITSEKGKWNRQIRCADLT 577 ++ VR+E T +G W+ RC DL+ Sbjct: 77 DKTVRMEFTESQGNWDVPSRCPDLS 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,791,498 Number of Sequences: 27780 Number of extensions: 262436 Number of successful extensions: 408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -