BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O03 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 1.9 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 3.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 4.4 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 315 ILCFMKVIFVALYATITIT 259 ILC + V+F+ALY +T T Sbjct: 7 ILCGIAVLFLALYYYLTST 25 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -1 Query: 613 WLRITGLHLIP--LGEIGTANLSIPF 542 W T IP LG IGT+NLS+ F Sbjct: 458 WCWDTRKEYIPQNLGVIGTSNLSLVF 483 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -1 Query: 337 LFKQILINFMFYESNFCGPLCYDNNHNFLNI 245 L ++ L N++F G C D NF + Sbjct: 399 LARRFLNNYLFLAVGIVGGACSDVEQNFYEV 429 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,708 Number of Sequences: 438 Number of extensions: 3118 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -