BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O01 (523 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22GV4 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_UPI00006CBA20 Cluster: hypothetical repeat containing p... 33 5.2 UniRef50_Q8II33 Cluster: Putative uncharacterized protein; n=1; ... 32 6.9 UniRef50_UPI000038CA36 Cluster: hypothetical protein Npun0200164... 32 9.2 UniRef50_Q4X3C7 Cluster: Putative uncharacterized protein; n=1; ... 32 9.2 >UniRef50_Q22GV4 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 249 Score = 33.5 bits (73), Expect = 3.0 Identities = 13/46 (28%), Positives = 28/46 (60%) Frame = +1 Query: 172 YVTSDITILIFKSVYEVL*FHVNNISLNILHFTFEFISYYFCYNFI 309 Y + +I + ++ ++ ++ +ISL + HF F+F++ YF +FI Sbjct: 167 YTPYQLVSIILRIIFWIIIYNKLSISLFLYHFLFDFMNIYFLKDFI 212 >UniRef50_UPI00006CBA20 Cluster: hypothetical repeat containing protein; n=1; Tetrahymena thermophila SB210|Rep: hypothetical repeat containing protein - Tetrahymena thermophila SB210 Length = 2555 Score = 32.7 bits (71), Expect = 5.2 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 241 NISLNILHFTFEFISYYFCYNFI 309 NI ++IL TF+F +YYF YN+I Sbjct: 931 NIEVDILQNTFQFNTYYFDYNYI 953 >UniRef50_Q8II33 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1057 Score = 32.3 bits (70), Expect = 6.9 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 2/66 (3%) Frame = +1 Query: 121 NN*NRKFSNNISIIQLFYVTSDITILIFKSVYEVL*FHV-NNISLNILHFTFEFISYYFC 297 NN N +NN +I Y D++ +IFK+++ L ++ N+I++ IL S ++ Sbjct: 822 NNNNNNNNNNNNISNNMYDKFDLSFIIFKNIFFFLKIYIDNDINIYILINHVIIPSLFYL 881 Query: 298 Y-NFIR 312 Y NF++ Sbjct: 882 YMNFLK 887 >UniRef50_UPI000038CA36 Cluster: hypothetical protein Npun02001640; n=1; Nostoc punctiforme PCC 73102|Rep: hypothetical protein Npun02001640 - Nostoc punctiforme PCC 73102 Length = 294 Score = 31.9 bits (69), Expect = 9.2 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 184 DITILIFKSVYEVL*FHVNNISLNILHFTFEFISYYF 294 D T++ F+ +E + +H N+IS +LH +FI YY+ Sbjct: 241 DETLIYFQQ-HEAIEYHKNSISQKLLHKLNKFIGYYY 276 >UniRef50_Q4X3C7 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 88 Score = 31.9 bits (69), Expect = 9.2 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +1 Query: 157 IIQLFYVTSDITILIFKSVYEVL*FHVNNISLNILHFTFEFISYYFC 297 II + ++ DI I++ K+ F+ + + N L F+F +IS YFC Sbjct: 11 IIIITFIRRDIIIIVMKTKISFR-FYKIHFTNNTLSFSFYYISIYFC 56 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 361,041,678 Number of Sequences: 1657284 Number of extensions: 5045305 Number of successful extensions: 8389 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8383 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -