BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_O01 (523 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0169 - 21303270-21303731,21304863-21304996,21305384-21305630 28 5.2 12_02_0384 + 18409831-18409843,18410378-18410471,18410614-184107... 27 6.9 >09_06_0169 - 21303270-21303731,21304863-21304996,21305384-21305630 Length = 280 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +2 Query: 161 YNYFM*HRILQYSFSSQFMKSYSFT*TTLV*IFYISHLSSF 283 ++ F+ H L ++S+ F+K + TL+ +F + SSF Sbjct: 92 FSDFLYHTCLSLAYSAHFLKMMAIIVVTLILLFQVQSKSSF 132 >12_02_0384 + 18409831-18409843,18410378-18410471,18410614-18410734, 18411635-18412543,18412772-18413211,18413481-18414516 Length = 870 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +2 Query: 161 YNYFM*HRILQYSFSSQFMKSYSFT*TTLV*IF----YISHLSSFHTIFAI 301 Y Y H +SF + + K Y F TLV I+ ++ H SSF T+ + Sbjct: 400 YMYLPPHLKRCFSFCAVYPKDYRFEKDTLVDIWLAEGFVEHASSFPTVTVV 450 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,802,119 Number of Sequences: 37544 Number of extensions: 111586 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -