BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N24 (402 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.11 |cox2||cytochrome c oxidase 2|Schizosaccharomyces pombe... 45 4e-06 SPCC1259.14c |meu27||S. pombe specific UPF0300 family protein 5|... 24 7.7 >SPMIT.11 |cox2||cytochrome c oxidase 2|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 248 Score = 45.2 bits (102), Expect = 4e-06 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 5/77 (6%) Frame = -2 Query: 224 RFLLEGQIIELI*TIIPAFTLIFIAXXXXXXXXXXXXXXXXLITLKSIGHQ*Y*RYEYSD 45 ++ G I+E I T+IPA LI +A +T+K+IG Q + YE +D Sbjct: 69 KYTTHGSIVEFIWTLIPALILILVALPSFKLLYLLDEVQKPSMTVKAIGRQWFWSYELND 128 Query: 44 F-----NNIEFDSYIIP 9 F + FDSY++P Sbjct: 129 FVTNENEPVSFDSYMVP 145 >SPCC1259.14c |meu27||S. pombe specific UPF0300 family protein 5|Schizosaccharomyces pombe|chr 3|||Manual Length = 736 Score = 24.2 bits (50), Expect = 7.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 103 GLLSSS-NKYNNRNDGKAMKINVKAGIIVQINSIIC 207 G LS NK +N+N KA + K G+ I I C Sbjct: 91 GFLSQQENKSSNQNPSKANNLFDKLGVSKPITFIAC 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,020,008 Number of Sequences: 5004 Number of extensions: 11268 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -