BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N24 (402 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032623-18|CAN99758.1| 330|Caenorhabditis elegans Hypothetical... 30 0.71 Z75533-6|CAA99819.1| 378|Caenorhabditis elegans Hypothetical pr... 26 8.8 >AL032623-18|CAN99758.1| 330|Caenorhabditis elegans Hypothetical protein Y43F8B.15 protein. Length = 330 Score = 29.9 bits (64), Expect = 0.71 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 396 NSAGRYGNMIKFKSTKWSFTFNRTNYFF 313 ++A GNMIKF W+ F+ TN F+ Sbjct: 211 DAAANRGNMIKFSINLWNAVFSFTNSFY 238 >Z75533-6|CAA99819.1| 378|Caenorhabditis elegans Hypothetical protein C54G4.7 protein. Length = 378 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 37 LLKSEYSYLQYH*CPIDFSVISGLLSSSNKYNNRNDG 147 +L +++ L+++ PID S+ L+ ++Y RN G Sbjct: 294 ILMDDFTSLEFYPTPIDTSLCHVFLADQDQYVLRNQG 330 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,399,081 Number of Sequences: 27780 Number of extensions: 57647 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -