BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N24 (402 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 5.3 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 5.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 5.3 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 20 9.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 20 9.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 20 9.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 20 9.2 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 5.3 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 115 SSNKYNNRNDGKAMKINV 168 ++N YNN N K + N+ Sbjct: 99 NNNNYNNNNYNKKLYYNI 116 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 5.3 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 115 SSNKYNNRNDGKAMKINV 168 ++N YNN N K + N+ Sbjct: 99 NNNNYNNNNYNKKLYYNI 116 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 5.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 79 PIDFSVISGLLSSSNKYNNRNDGKAMKINV 168 P S +S + SN Y N N+ K + N+ Sbjct: 301 PKIISSLSNSCNYSNNYYNNNNYKKLYYNI 330 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 6.9 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 91 SVISGLLSSSNKYNNRNDGKAMKINVKAGIIVQI 192 S+ + + ++N YNN N K+ I Q+ Sbjct: 84 SLSNKTIHNNNNYNNNNYNNYKKLYYNINYIEQV 117 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 59 YEYSDFNNIEFDSY 18 Y+YS++NN ++Y Sbjct: 89 YKYSNYNNYNNNNY 102 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 59 YEYSDFNNIEFDSY 18 Y+YS++NN ++Y Sbjct: 89 YKYSNYNNYNNNNY 102 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 59 YEYSDFNNIEFDSY 18 Y+YS++NN ++Y Sbjct: 89 YKYSNYNNYNNNNY 102 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 59 YEYSDFNNIEFDSY 18 Y+YS++NN ++Y Sbjct: 89 YKYSNYNNYNNNNY 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,699 Number of Sequences: 438 Number of extensions: 870 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10008927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -