BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N22 (748 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2EAN4 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_Q9EMP3 Cluster: AMV156; n=1; Amsacta moorei entomopoxvi... 33 9.9 >UniRef50_A2EAN4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 323 Score = 33.1 bits (72), Expect = 7.5 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 353 THINMKIFVTFIVPKIYV*EYILRISSLLIMQ*NINKFEILCTEYFC 493 TH+ ++V I+ YV IL +SS++I+ ++++ LC YFC Sbjct: 243 THVYKNVYVGNIIS--YVFSSILLLSSIIILLITFSRYQNLCCFYFC 287 >UniRef50_Q9EMP3 Cluster: AMV156; n=1; Amsacta moorei entomopoxvirus 'L'|Rep: AMV156 - Amsacta moorei entomopoxvirus (AmEPV) Length = 1238 Score = 32.7 bits (71), Expect = 9.9 Identities = 20/59 (33%), Positives = 31/59 (52%) Frame = +1 Query: 220 NILRKYF*KISILYNFII*HNAYHISLIKHTHVKISTKHLI*LKYTY*YENICYFYSSK 396 + L KY KI+ +N I +N+Y L ++ + S +I YTY E+I Y+ S K Sbjct: 982 DFLNKYINKINNTFNIKILNNSYKKILFEYDNNSNSINDIIKNIYTYKTEDISYYISIK 1040 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,690,780 Number of Sequences: 1657284 Number of extensions: 10602399 Number of successful extensions: 20978 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20975 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61323318355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -