BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N22 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0050 + 11959421-11959736,11959892-11959960,11960641-119609... 32 0.42 04_04_0412 + 25023758-25023826,25023927-25023991,25024082-250241... 29 5.2 >01_03_0050 + 11959421-11959736,11959892-11959960,11960641-11960979, 11961090-11961152,11962472-11962962,11963773-11964441 Length = 648 Score = 32.3 bits (70), Expect = 0.42 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +1 Query: 292 ISLIKHTHVKISTKHLI*LKYTY*YENICYFYSSKNLRLRIYFENIIPPNNAI 450 +SL+ H H+K+S K L K ++ Y+ Y S K L I + P +A+ Sbjct: 323 VSLVDHAHIKVSEKRLRTQKRSFSYKKDRYSKSKKKKNLNILSKEEDKPAHAV 375 >04_04_0412 + 25023758-25023826,25023927-25023991,25024082-25024145, 25024806-25024940,25025029-25025160,25025470-25025553, 25025638-25025736,25025992-25026083,25026280-25026352, 25026476-25026628,25026721-25026840,25026926-25026979, 25027188-25027271,25027431-25027505,25027585-25027728, 25028016-25028123,25028340-25028459,25028909-25029102, 25029193-25029319 Length = 663 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 496 KTKVLCTQNLKFINILLHY 440 ++ +LC LKF+N LLHY Sbjct: 495 RSSILCRSMLKFVNSLLHY 513 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,575,950 Number of Sequences: 37544 Number of extensions: 231457 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -