BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N17 (893 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.71 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 24 2.2 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 5.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 8.7 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.4 bits (53), Expect = 0.71 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 232 ILFIWLLALCLCV 194 I+ IWLLALCL V Sbjct: 175 IIVIWLLALCLAV 187 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 23.8 bits (49), Expect = 2.2 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 357 QKVKEEEVEA*TS*YLNH*DLSPTVNNYVMCPIVCLSAKRLKFYLSGC-LRCV 202 ++++EE +E T ++ L P + V C ++ +K L S C +RC+ Sbjct: 34 RQIEEENIEPDTELMDSNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIRCL 86 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = -1 Query: 713 VNLRTLTTPTKILLRGFAKTTMNASLVLKMKNSIWN 606 + + + P LL GF ++T + + ++ N WN Sbjct: 13 IGVLLMLAPINALLLGFVQSTPDNNKTVREFNVYWN 48 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 6.6 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -2 Query: 562 PSQRPQRQIRQAHTKEGF---QIRKQIRQAPEEGRRIQLP*PIEGREKEGIHLGRGRQ 398 P P++Q +QA +G + +Q + AP+ LP P+ + RGRQ Sbjct: 219 PGMHPRQQ-QQAQQHQGVVTSPLSQQQQAAPQGAASANLPSPLYPWMRSQFERKRGRQ 275 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 8.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 849 PFWLWRPPPCAGAP 890 PF W PPP +P Sbjct: 1160 PFNFWNPPPFMPSP 1173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,283 Number of Sequences: 438 Number of extensions: 3175 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28904421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -