BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N16 (622 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0558 + 4521616-4522296 27 9.1 02_01_0529 - 3846489-3847268 27 9.1 >12_01_0558 + 4521616-4522296 Length = 226 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 144 PLTASQVARGQTFSIPVPTSRCSKSQEVQL*PQKHSLSRSSLSKVYI 284 P+T + A G P PT+ CS S L P + L SS S + + Sbjct: 4 PVTPASSAAGAPPPPPPPTTTCSTSCRFVLPPTRRHLLASSASSLLL 50 >02_01_0529 - 3846489-3847268 Length = 259 Score = 27.5 bits (58), Expect = 9.1 Identities = 20/74 (27%), Positives = 30/74 (40%) Frame = +3 Query: 111 PQAYYHPILGIPLTASQVARGQTFSIPVPTSRCSKSQEVQL*PQKHSLSRSSLSKVYIRI 290 P A Y P +P + V G S P PT+ S + QL Q+ L + + Sbjct: 24 PAAAYPPQAMVPGAPAVVPPGSQPSAPFPTNPAQLSAQHQLVYQQAQQFHQQLQQQQQQQ 83 Query: 291 LQELMVNESDPYTQ 332 L+E N+ + Q Sbjct: 84 LREFWANQMEEIEQ 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,014,835 Number of Sequences: 37544 Number of extensions: 281521 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -