BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N16 (622 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 26 0.26 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 7.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.7 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 26.2 bits (55), Expect = 0.26 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +3 Query: 24 IVFYIYIYSDGLQFYCKFQTQLKKILSESPQAYY 125 I ++I++Y + L + +F +L K+L ESP+ Y Sbjct: 19 INYFIFLYFNSLVRFRRFTIELDKVL-ESPRGKY 51 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 7.3 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 338 DKSKALTDKQRIPLRHLCKNYFII*VNYN*DLYVNK 445 DK + K+R + L NY NYN D NK Sbjct: 69 DKRERERSKERKIISSLSNNYISNISNYNNDNNYNK 104 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 9.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 38 LHIF*WTPILL*VSNSAQKNTF*VTSSLLSSNTRNPINSISSGQR 172 LH+ +P S+ AQ + T+SLLSS S+ G R Sbjct: 671 LHLHLTSPPARSPSSQAQASQCPQTASLLSSTHSTLARSLMEGPR 715 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,276 Number of Sequences: 438 Number of extensions: 3503 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -