BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N14 (802 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 262 2e-70 SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) 122 4e-28 SB_7140| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 30 1.9 SB_29472| Best HMM Match : DUF964 (HMM E-Value=4.7) 30 2.5 SB_51282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 29 5.8 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 29 5.8 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 29 5.8 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 5.8 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 29 5.8 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 29 5.8 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 29 5.8 SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) 28 7.7 SB_6540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 262 bits (642), Expect = 2e-70 Identities = 123/166 (74%), Positives = 135/166 (81%), Gaps = 1/166 (0%) Frame = -3 Query: 800 MIRYCSVVRVIAHTQMKLLKQRQKKAHIMEIQLNGGT-IEDKVKWAREHLEKPIPVDSVF 624 M +YC V+RVI HTQ KLLK RQKKAHIMEIQ+NGG + +KV W RE LE P PV VF Sbjct: 152 MKKYCKVIRVICHTQQKLLKMRQKKAHIMEIQVNGGKDVAEKVDWCRERLENPAPVRKVF 211 Query: 623 AQDEMIDCIXXXXXXXXXXXTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSFTVARAGQ 444 + DEMID I T RW TKKLPRKTHKGLRKVACIGAWHP+RVSF+VARAGQ Sbjct: 212 SPDEMIDVIGVTKGHGFKGVTYRWGTKKLPRKTHKGLRKVACIGAWHPARVSFSVARAGQ 271 Query: 443 KGYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLSEKSITPM 306 GYHHRTE+NKKIYRIGQGIHKKDGKVIKNNASTEYDL++KSI+PM Sbjct: 272 AGYHHRTELNKKIYRIGQGIHKKDGKVIKNNASTEYDLTDKSISPM 317 >SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) Length = 347 Score = 122 bits (293), Expect = 4e-28 Identities = 57/86 (66%), Positives = 66/86 (76%) Frame = -3 Query: 305 GGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEKINLKFIDTSSKFGHG 126 GGFPHYG+VN DF+M+KGC +GPKKR++TLRKSL VHT R A EKI LKFIDTSSKFGHG Sbjct: 215 GGFPHYGQVNEDFLMVKGCVVGPKKRVLTLRKSLLVHTSRDAAEKITLKFIDTSSKFGHG 274 Query: 125 RFQTPAXQGCITWGHYKKEXMREEAA 48 RFQ PA + G K + +E AA Sbjct: 275 RFQHPAEKRAF-MGMLKSDREKELAA 299 >SB_7140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 97.1 bits (231), Expect = 1e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -3 Query: 440 GYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLSEKSITPM 306 GYHHRTE+NKKIYRIGQGIHKKDGKVIKNNASTEYDL++KSITPM Sbjct: 2 GYHHRTELNKKIYRIGQGIHKKDGKVIKNNASTEYDLTDKSITPM 46 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 397 LDKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 LDK MA + HLLS+T RNP LH++E++ Sbjct: 247 LDKRFQDEMAFNVSKCHLLSVTNKRNPSLHEYEIN 281 >SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) Length = 270 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -3 Query: 194 TKRAALEKINLKFIDTSSKFGHGRFQTPAXQGCITWGHYKKE 69 +KR L K KF+ + F H Q G I WG KK+ Sbjct: 215 SKRLGLLKRTKKFLSARTLFYHSLIQPILDYGAIVWGSTKKQ 256 >SB_29472| Best HMM Match : DUF964 (HMM E-Value=4.7) Length = 344 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = +3 Query: 72 LLVVSPCNAALXSRRLESTMTELGRGVNEFEVDLF*CSPLCMHTQRLSKSNDTLFRSHAA 251 +++ PCN ST E G G++E E+ LF S L LS S+ + Sbjct: 232 IIITPPCNEETKETEELSTKPEQGEGLSEDELALFHNSLLLKTNSYLSLSSSMPDLAKIG 291 Query: 252 TLDHHKVV 275 +D ++V+ Sbjct: 292 FMDFNEVI 299 >SB_51282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 380 KKDGKVIKNNASTEYDLSEKSITPMGGFPHYGEVNNDFVMIK 255 KK V +N+ T D + + GFPHY + +D + IK Sbjct: 44 KKCWTVTQNDVPTPLDCGLSAWRILSGFPHYKLIEDDHIEIK 85 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 173 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 206 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 204 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 237 >SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) Length = 347 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 275 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 308 >SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 59 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 92 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 1091 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 1124 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 1283 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 1316 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 643 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 676 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 832 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 865 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 895 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 928 >SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 75 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 108 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 394 DKESTKRMAKLLKTMHLLSMTCLRNP-LHQWEVS 296 D T +MA + HLLS+T RNP LH++E++ Sbjct: 979 DWSDTWQMAFNVSKCHLLSVTNKRNPSLHEYEIN 1012 >SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1918 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 765 PHSNEAVKTATKEGSHYGNPT*RWYHRGQSEMGQ-RTSGETYP 640 PH N + T G H NPT HR S GQ R +G P Sbjct: 282 PHQNGSNVTNIPVGGHPSNPTPAAIHRSMSVGGQPRVNGPGNP 324 >SB_6540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 236 KKRIITLRKSLRVHTKRAALEKINLKFIDTSSKFGHGRFQTPA 108 K R++ +K ++H+ + K ++F+ SKF H T A Sbjct: 317 KDRLLEWKKERQIHSFSSTTLKARIRFVAAMSKFAHTTEDTTA 359 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,313,213 Number of Sequences: 59808 Number of extensions: 569621 Number of successful extensions: 1237 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1235 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -