BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N13 (409 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 23 0.87 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 2.7 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.1 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 23.4 bits (48), Expect = 0.87 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 388 HKLKRLNYGRNSNTYTMDASVLNSTCQTLCGKS 290 HK+ L+ G+N TY D L+ LC ++ Sbjct: 189 HKIV-LDMGKNCVTYVFDLFYLSKRASDLCNEA 220 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.8 bits (44), Expect = 2.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 179 AVCGFPTYCSNVPGI 135 ++CG +C N+PG+ Sbjct: 36 SICGEHGHCVNLPGV 50 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 20.6 bits (41), Expect = 6.1 Identities = 8/29 (27%), Positives = 13/29 (44%) Frame = -1 Query: 385 KLKRLNYGRNSNTYTMDASVLNSTCQTLC 299 K K + Y ++++L S C LC Sbjct: 171 KYKTVTYVMTGQLKAQNSNLLKSVCADLC 199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,080 Number of Sequences: 336 Number of extensions: 1402 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8857716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -