BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N13 (409 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL592301-8|CAI13937.1| 108|Homo sapiens serologically defined c... 29 8.0 >AL592301-8|CAI13937.1| 108|Homo sapiens serologically defined colon cancer antigen 3 protein. Length = 108 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 249 DRGRSQGERSAEFADFPQSVWHVLFNTDASI 341 D G +G R FP+ VWH+ +T +SI Sbjct: 14 DTGERRGRRPRGRFQFPRHVWHLRCSTSSSI 44 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,253,867 Number of Sequences: 237096 Number of extensions: 783810 Number of successful extensions: 1440 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1440 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 3043111070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -