BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N12 (775 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H4.09 |cdb4||curved DNA-binding protein Cdb4|Schizosacchar... 36 0.005 SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Ma... 27 3.9 SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual 26 5.2 SPBP35G2.07 |ilv1||acetolactate synthase catalytic subunit|Schiz... 26 5.2 SPAC4F8.04 |||Brix domain protein Rpf1|Schizosaccharomyces pombe... 26 6.9 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 26 6.9 SPCC297.05 |||diacylglycerol binding protein |Schizosaccharomyce... 25 9.1 >SPAC23H4.09 |cdb4||curved DNA-binding protein Cdb4|Schizosaccharomyces pombe|chr 1|||Manual Length = 381 Score = 36.3 bits (80), Expect = 0.005 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = -2 Query: 771 QLIEPFQVLYERPGELVAQFKFTALLLPSGTHRITGLPFDKSQCKSERSIKDPE 610 +L+ P++VL ++ G +VA+F T L GT ++ + KS++ ++DPE Sbjct: 302 KLLFPYEVLLDKDGGIVAEFYSTIALTKKGTIILSDSEPKEDFIKSDKKVEDPE 355 >SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Manual Length = 462 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 335 PRSEKILGLFVGTKLDIYSHNYKSRCGCLSKKLHNFCYFC 454 PR +L V +LD S CG L+++ HNF C Sbjct: 95 PRLVVVLPWTVLQELDGLKSESSSTCGYLARQAHNFLLQC 134 >SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 26.2 bits (55), Expect = 5.2 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 425 Y*DNHILTYS-YVNKYLALYLQTNPRSSLILA*TPECL 315 Y +N ILT + V+ YL YLQ NP + IL P+ L Sbjct: 77 YMENGILTSTDIVHCYLDRYLQVNPYVNGILQLNPDVL 114 >SPBP35G2.07 |ilv1||acetolactate synthase catalytic subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 669 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 106 VFVHNYISSGMINLIIIKFYHKTYLHVHKNNCIFIYL 216 + + N GM+ FY K Y H H+ N F+ L Sbjct: 570 ILILNNEEQGMVTQWQNLFYEKRYSHTHQKNPNFVKL 606 >SPAC4F8.04 |||Brix domain protein Rpf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 6.9 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 5/88 (5%) Frame = -3 Query: 593 IHQQN---LTRRRKR-KQELKSPWKWRLLPSKNT*VPRNK*Y*HFSTI*MDKNNKNCAIF 426 +HQ+N L RR++R K+E K P K RL S+N + TI DK ++ Sbjct: 18 LHQKNKDKLERRKERAKEEEKDPEKKRLRLSENIPATIESKRVYDETIIEDKPDEELQAE 77 Query: 425 Y*DNHILTY-SYVNKYLALYLQTNPRSS 345 D+ Y S K L + T+ R+S Sbjct: 78 LKDDEFSAYFSEERKVPKLLVTTSKRAS 105 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 25.8 bits (54), Expect = 6.9 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -3 Query: 770 NSLSHSRFXMSVQENWWHSLSSRLFCF 690 ++L H+RF + +W H+ + ++CF Sbjct: 4034 HTLPHNRFRLFFFLSWLHATLAEIYCF 4060 >SPCC297.05 |||diacylglycerol binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 25.4 bits (53), Expect = 9.1 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -1 Query: 508 IHKCPGINDINIFPQYKWTKITKIVQFF 425 +++ PG ND++++P ++ I I+ F Sbjct: 449 VNEIPGWNDVDLYPLFRALSIPNILVLF 476 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,966,473 Number of Sequences: 5004 Number of extensions: 60211 Number of successful extensions: 145 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -