BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N12 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51800.1 68416.m05680 metallopeptidase M24 family protein sim... 54 1e-07 At3g51800.2 68416.m05681 metallopeptidase M24 family protein sim... 43 3e-04 At5g07330.1 68418.m00837 expressed protein 28 7.9 At3g23430.1 68416.m02953 phosphate transporter, putative (PHO1) ... 28 7.9 >At3g51800.1 68416.m05680 metallopeptidase M24 family protein similar to SP|P50580 Proliferation-associated protein 2G4 {Mus musculus}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 392 Score = 53.6 bits (123), Expect = 1e-07 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = -2 Query: 765 IEPFQVLYERPGELVAQFKFTALLLPSGTHRITGLPFDKSQCKSERSIKDPE 610 ++P+ VLYE+PG+ VAQ KFT LL+P+G+ RIT Q +++I+DPE Sbjct: 299 LQPYPVLYEKPGDFVAQIKFTVLLMPNGSDRITS---HTLQELPKKTIEDPE 347 >At3g51800.2 68416.m05681 metallopeptidase M24 family protein similar to SP|P50580 Proliferation-associated protein 2G4 {Mus musculus}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 401 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 9/61 (14%) Frame = -2 Query: 765 IEPFQVLYERPG---------ELVAQFKFTALLLPSGTHRITGLPFDKSQCKSERSIKDP 613 ++P+ VLYE+PG + VAQ KFT LL+P+G+ RIT Q +++I+DP Sbjct: 299 LQPYPVLYEKPGSCRFGFLPGDFVAQIKFTVLLMPNGSDRITS---HTLQELPKKTIEDP 355 Query: 612 E 610 E Sbjct: 356 E 356 >At5g07330.1 68418.m00837 expressed protein Length = 165 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 109 FVHNYISSGMINLIIIKFYHKTYLHVHKN 195 F Y+S G+I+L + + YLH+H+N Sbjct: 54 FTPVYVSIGLISLSVTFGVYTAYLHLHEN 82 >At3g23430.1 68416.m02953 phosphate transporter, putative (PHO1) identical to PHO1 protein [Arabidopsis thaliana] GI:20069032; supporting cDNA gi|20069031|gb|AF474076.1|; contains Pfam profiles PF03124: EXS family and PF03105: SPX domain Length = 782 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 431 LHNFCYFCPFILWKNVNIIYSW 496 LH F Y C +WKN I Y++ Sbjct: 437 LHMFMYGCNLYMWKNTRINYTF 458 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,057,155 Number of Sequences: 28952 Number of extensions: 292991 Number of successful extensions: 584 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -