BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_N06 (541 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizos... 26 3.1 SPCC663.08c |||short chain dehydrogenase |Schizosaccharomyces po... 26 4.1 SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p... 25 5.4 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 25 5.4 SPAC29B12.14c |||purine transporter |Schizosaccharomyces pombe|c... 25 7.2 SPAC869.11 ||SPAC922.08c|amino acid permease, unknown 6|Schizosa... 25 7.2 SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pom... 25 7.2 SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosacch... 25 7.2 SPBC2D10.06 |rep1|rec16|MBF transcription factor complex subunit... 25 9.5 SPAC1F8.01 |ght3||hexose transporter Ght3 |Schizosaccharomyces p... 25 9.5 >SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 650 Score = 26.2 bits (55), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 356 QFFARKLNARHVKHPGHGFKG 294 QF RKL H KH HG G Sbjct: 213 QFIFRKLGLHHGKHGHHGHSG 233 >SPCC663.08c |||short chain dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 253 Score = 25.8 bits (54), Expect = 4.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 276 MLGPKPAFEAMSWMFDMPCIKLAGEKLLAFIGNMFGSLGTAAPSN 410 +LGP ++A P IK K++ F ++ GS+G PS+ Sbjct: 115 VLGPIHVYQAF-----YPLIKKGRSKIIVFTSSLAGSMGAFFPSS 154 >SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 226 Score = 25.4 bits (53), Expect = 5.4 Identities = 10/24 (41%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +3 Query: 159 ICCFHLLKSMVDIFPFSLI-SSFV 227 + CFHL+ + + +FP+++I +SFV Sbjct: 44 LLCFHLVPNALFLFPWTIITTSFV 67 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.4 bits (53), Expect = 5.4 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = +3 Query: 120 IS*CIRYFF*IKLICCFHLLKSMVDIFPFSLISSFVIFFPALSTTVEMAAPFMLGPKPAF 299 +S R F ++++ +L ++ +F +LIS F F A + + PF L K F Sbjct: 1041 LSRAFRAFKALRVLRLINLTQTSQRMFHDALISGFFKIFSAAVVSATLLIPFALWAKNVF 1100 >SPAC29B12.14c |||purine transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 25.0 bits (52), Expect = 7.2 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +3 Query: 189 VDIFPFSLISSFVIFFPALSTTVEMAAPFMLGPKPAFEAMSW 314 V F F LIS+ I+FP A L P A + W Sbjct: 186 VGFFIFWLISNVAIWFPVYQIRHLFTAKSFLAPPAAIAFLIW 227 >SPAC869.11 ||SPAC922.08c|amino acid permease, unknown 6|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.0 bits (52), Expect = 7.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -1 Query: 451 KVAIILLILAAVYGLEGAAVPNDPNIFPINANSFSPASLMQGMSNIQDMAS 299 ++AI ++ + GL P+DPN+ + S SP L +NI+ + S Sbjct: 307 RIAIFYVVSLILIGL--LISPDDPNLMGNGSTSVSPFVLAIKEANIKGLPS 355 >SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pombe|chr 2|||Manual Length = 1067 Score = 25.0 bits (52), Expect = 7.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 445 AIILLILAAVYGLEGAAVPNDPNIFPINAN 356 A +L I AV G + N PNIFPI N Sbjct: 361 AALLSIGVAVEGSSESVAGNLPNIFPIIIN 390 >SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 25.0 bits (52), Expect = 7.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 400 AAVPNDPNIFPINANSFSPASLMQGMSNIQDM 305 AAV NDPN F S + + L+Q S+ M Sbjct: 31 AAVLNDPNAFATTWQSINASQLLQIPSSTYSM 62 >SPBC2D10.06 |rep1|rec16|MBF transcription factor complex subunit Rep1|Schizosaccharomyces pombe|chr 2|||Manual Length = 472 Score = 24.6 bits (51), Expect = 9.5 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -1 Query: 400 AAVPNDPNIFPINANSFSPASLMQGMS--NIQDMASKAGFG-PNMNG 269 AA P DPN++ +N N S N + A GF N+NG Sbjct: 273 AAFPFDPNVYALNTNDGPVTSTDNNCDQLNTRMQAWNNGFNYSNLNG 319 >SPAC1F8.01 |ght3||hexose transporter Ght3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 555 Score = 24.6 bits (51), Expect = 9.5 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 456 IV*VYLRMFKNNYYAYFSCKLFSST 530 +V ++ + NNYY Y++ ++F T Sbjct: 271 LVMLFRELIGNNYYFYYATQVFKGT 295 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,006,509 Number of Sequences: 5004 Number of extensions: 36678 Number of successful extensions: 106 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -