BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M22 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27350.1 68418.m03266 sugar-porter family protein 1 (SFP1) id... 27 9.8 >At5g27350.1 68418.m03266 sugar-porter family protein 1 (SFP1) identical to sugar-porter family protein 1 [Arabidopsis thaliana] GI:14585699 Length = 474 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +1 Query: 46 CQLLGSAHQFNKSQMSALHNQLQNHM--ILHLIA*CVQKSKIHYIIMSNSLPLCKKKWKF 219 C LLG A K Q+ + + + + ++++ + + ++IMS P+ K Sbjct: 342 CMLLGVAFTLQKMQLLSELTPILSFICVMMYIATYAIGLGGLPWVIMSEIFPINIKVTAG 401 Query: 220 SIPTKLKFKIDKTLNTSFNMKF 285 SI T + F + +FN F Sbjct: 402 SIVTLVSFSSSSIVTYAFNFLF 423 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,665,571 Number of Sequences: 28952 Number of extensions: 251891 Number of successful extensions: 353 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -