BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M21 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces po... 27 3.3 SPAC23G3.05c |||regulator of G-protein signaling |Schizosaccharo... 25 9.9 >SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 26.6 bits (56), Expect = 3.3 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +2 Query: 143 KLIHLYINKLIRSKFLRYLYNINIPTKCIIDFF---SLIIWYCLSYLHKLPTYIEVLFC* 313 +L+H + + R+ L+ L N+P + + SLI+W K P+ +EVL C Sbjct: 526 ELLHPFQTNMERATKLQDLRRGNLPEEFVEQHICESSLILWMTAKDPTKRPSLLEVLNCG 585 Query: 314 YEFPTFQRKPWLEAIMA 364 P P + I++ Sbjct: 586 LLLPNQVSMPNISNIVS 602 >SPAC23G3.05c |||regulator of G-protein signaling |Schizosaccharomyces pombe|chr 1|||Manual Length = 343 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 222 FVGIFILYKYRKNLLLINLFIYK*MSLMPTWS 127 F GIF+ Y RK + + F + +L+ TWS Sbjct: 251 FCGIFLDYSRRKRVWTLLPFAFGFYNLICTWS 282 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,557,831 Number of Sequences: 5004 Number of extensions: 52098 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -