BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M16 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 26 0.42 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 26 0.42 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 26 0.42 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 3.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.2 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 9.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.1 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 121 LEKKLPLDEFVTHNVPLKEINEAFHLMHAGKAXR 20 L +PLD ++ +E+F ++HAG+A R Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILHAGRALR 206 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 121 LEKKLPLDEFVTHNVPLKEINEAFHLMHAGKAXR 20 L +PLD ++ +E+F ++HAG+A R Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILHAGRALR 206 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 121 LEKKLPLDEFVTHNVPLKEINEAFHLMHAGKAXR 20 L +PLD ++ +E+F ++HAG+A R Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILHAGRALR 206 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 407 KFIDSKFLSYLKLVRVDVNTNNAIGTC 487 + D +Y KLVR VNT++ + C Sbjct: 31 RLYDDLLSNYNKLVRPVVNTSDVLRVC 57 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 407 KFIDSKFLSYLKLVRVDVNTNNAIGTC 487 + D +Y KLVR VNT++ + C Sbjct: 31 RLYDDLLSNYNKLVRPVVNTSDVLRVC 57 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 391 YDKPIQQVLVDLTDGGLEYTFECIGN 314 +D+ Q+V+ G LE F C+GN Sbjct: 140 FDQLGQEVIYTACVGLLERAFRCLGN 165 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 310 LHFQYIQKCILDHHQSNPPV 369 L +Y+++C+L+ + PPV Sbjct: 395 LEMKYLERCLLETLRMYPPV 414 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 267 PHPLWQASSAALMVPTFPIHSKVYSR 344 PH WQ S+A L+ F ++V R Sbjct: 105 PHMAWQLSTAHLLAQLFLKSTEVTPR 130 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 454 NPDKFEVAKKFGVNEFVNPKDYDKP 380 N E +FG + +N K+YD P Sbjct: 17 NSASLENDNEFGFSYLLNCKNYDHP 41 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 9.1 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -3 Query: 384 NQFNKYWW 361 N+ NK+WW Sbjct: 361 NEMNKWWW 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,889 Number of Sequences: 438 Number of extensions: 3886 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -