BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M15 (818 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 26 0.36 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 26.2 bits (55), Expect = 0.36 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 152 RTFCLTSNTFRDLIDIGLNK 93 +T LT N RD+ DIGLN+ Sbjct: 174 QTLNLTENRLRDINDIGLNR 193 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.4 bits (48), Expect = 2.6 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -3 Query: 297 PHLKNLNYHLIKTYDLPTSRVVLTVYFLGAILTV*RFFLIRHF--DRETIPYIL 142 PH K L +HL K T+ ++ F+ L L+R F + + IP L Sbjct: 355 PHQKKLRFHLAKERKASTTLGIIMSAFIVCWLPFFVLALVRPFLKNPDAIPAFL 408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,629 Number of Sequences: 438 Number of extensions: 3473 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -