BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M15 (818 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g29270.2 68416.m03675 expressed protein 28 8.6 At3g29270.1 68416.m03674 expressed protein 28 8.6 >At3g29270.2 68416.m03675 expressed protein Length = 263 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 270 LIKTYDLPTSRVVLTVYFLGAILTV*RFFLIRHF 169 LI Y +PTS +L +Y L +L FLI +F Sbjct: 216 LIILYAIPTSAAILAMYILVTLLLALPSFLILYF 249 >At3g29270.1 68416.m03674 expressed protein Length = 263 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 270 LIKTYDLPTSRVVLTVYFLGAILTV*RFFLIRHF 169 LI Y +PTS +L +Y L +L FLI +F Sbjct: 216 LIILYAIPTSAAILAMYILVTLLLALPSFLILYF 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,152,057 Number of Sequences: 28952 Number of extensions: 237151 Number of successful extensions: 433 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -