BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M12 (470 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH... 27 4.8 At5g59510.1 68418.m07458 expressed protein 27 6.4 >At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH-like protein Pftf precursor GI:4325041 from [Nicotiana tabacum] Length = 687 Score = 27.5 bits (58), Expect = 4.8 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 107 KKD**FMK*LNLTEMIHFDADSFFTQTFRHKYTRRTQKNKFLSFFTAISYSA 262 KK F K +L++ H S TQ HK+T+R LS TA+ +++ Sbjct: 22 KKSQQFQKPASLSKSSHTHKPSLKTQILHHKFTKR----NLLSLTTALGFTS 69 >At5g59510.1 68418.m07458 expressed protein Length = 144 Score = 27.1 bits (57), Expect = 6.4 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 137 NLTEMIHFDADSFFTQTFRHKYTRRTQKNKFLSFFTA--ISYSAFEP 271 ++ E HF + FT++F K + + K F F+ SYS+ EP Sbjct: 14 SIFETTHFSSKPVFTRSFSTKTSSSSSKPVFTRSFSTKPTSYSSSEP 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,715,693 Number of Sequences: 28952 Number of extensions: 187157 Number of successful extensions: 391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -