BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_M07 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45977| Best HMM Match : MBT (HMM E-Value=0) 34 0.11 SB_25304| Best HMM Match : HDV_ag (HMM E-Value=0.55) 33 0.26 SB_4005| Best HMM Match : CAP_GLY (HMM E-Value=5.8e-17) 32 0.45 SB_30122| Best HMM Match : YadA (HMM E-Value=2) 31 1.0 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 30 1.4 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 30 1.8 SB_29638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) 29 2.4 SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_54026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_13658| Best HMM Match : MbeD_MobD (HMM E-Value=2.3) 29 3.2 SB_5235| Best HMM Match : DnaJ (HMM E-Value=3.4) 29 3.2 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 29 4.2 SB_57931| Best HMM Match : Vicilin_N (HMM E-Value=0.96) 28 5.6 SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) 28 5.6 SB_28246| Best HMM Match : M (HMM E-Value=0.0007) 28 5.6 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09) 28 5.6 SB_1837| Best HMM Match : Big_4 (HMM E-Value=8.1) 28 5.6 SB_13326| Best HMM Match : RVT_1 (HMM E-Value=1.3) 28 7.4 SB_57676| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_50721| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_45929| Best HMM Match : ANF_receptor (HMM E-Value=4.8e-24) 27 9.7 SB_33539| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) 27 9.7 SB_38914| Best HMM Match : BAH (HMM E-Value=1.3e-08) 27 9.7 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) 27 9.7 SB_5814| Best HMM Match : PKD (HMM E-Value=6.3e-10) 27 9.7 >SB_45977| Best HMM Match : MBT (HMM E-Value=0) Length = 1198 Score = 33.9 bits (74), Expect = 0.11 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 1/97 (1%) Frame = -2 Query: 617 PXDDVTSSLAHLRIIISLLNTNKMIAIEAEQQALPKDDMIQKAEPTTSQRTLTRSSAISQ 438 P + V S L +R + L ++ + + + P+D + + T + R T +SA S+ Sbjct: 141 PVEPVKSVLTPIRSSLPLTSSPQANVACSTTEPAPQDQVSSSCKTTETSRPETSTSATSE 200 Query: 437 KSVDVIVHPESSNNPL-YRSKLAPVRSSSETQPGKKT 330 ++ I H ES+ P S V+ + P KK+ Sbjct: 201 ETNSTINHTESTKEPEGTPSNEVKVKQEDASLPMKKS 237 >SB_25304| Best HMM Match : HDV_ag (HMM E-Value=0.55) Length = 2153 Score = 32.7 bits (71), Expect = 0.26 Identities = 23/74 (31%), Positives = 36/74 (48%) Frame = -2 Query: 515 PKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGK 336 P+ + Q + +QR+ T S IS KS I P+S + ++ P SSS T P Sbjct: 789 PQSVLEQLTKTGRTQRSKTTES-ISSKSGSSITTPQSDKDRANCTRYIPKCSSSATTPPS 847 Query: 335 KTITLRKTKNSSIE 294 K + T++SS + Sbjct: 848 KNARPKTTESSSTQ 861 >SB_4005| Best HMM Match : CAP_GLY (HMM E-Value=5.8e-17) Length = 560 Score = 31.9 bits (69), Expect = 0.45 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 2/118 (1%) Frame = -2 Query: 560 NTNKMIAI--EAEQQALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLY 387 NT + + + EA LP+++ Q +PT + + RS+ S + +++ + ES + Y Sbjct: 346 NTYRFLQVPDEAIFDHLPEEEKWQFLDPTIDKASFERSAKPSCEMLEMGIELESHKDYAY 405 Query: 386 RSKLAPVRSSSETQPGKKTITLRKTKNSSIESTMSLPNQKSLEKKHGGLRHQKAVGAQ 213 + + + PG+K + + K K S S +L ++ + + GL HQ + AQ Sbjct: 406 ETPTDTIDMTFYC-PGRKMLLMGKVKTS---SGQALEGRERVRLRFKGL-HQIEMRAQ 458 >SB_30122| Best HMM Match : YadA (HMM E-Value=2) Length = 408 Score = 30.7 bits (66), Expect = 1.0 Identities = 25/105 (23%), Positives = 49/105 (46%) Frame = -2 Query: 572 ISLLNTNKMIAIEAEQQALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNP 393 +++ T K + E +++ P+D M AE + +T TRS + S + S +P Sbjct: 84 VTIKPTVKTVLSEPSRRS-PEDIM---AEARSENQTHTRSLSSSSSENSLSFKVTKSTSP 139 Query: 392 LYRSKLAPVRSSSETQPGKKTITLRKTKNSSIESTMSLPNQKSLE 258 + +K P SSS +P + +T ++S +T + ++E Sbjct: 140 ITVTKATPAWSSSAWKPNRPPVTQSIGMSTSAVTTCTSSCHTTIE 184 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 30.3 bits (65), Expect = 1.4 Identities = 26/120 (21%), Positives = 49/120 (40%), Gaps = 8/120 (6%) Frame = -2 Query: 563 LNTNKMIAIEAEQQALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYR 384 LN + + E++ + D+ + K + R S V+ + E NN + Sbjct: 496 LNIRENERADLERKVMESDNKLAKLQSQLDAALTARDRLKSDLQVEKMKAGELKNNLIKT 555 Query: 383 S------KLAPVRSSSETQPGKKTITLRKTKNSSIESTMS--LPNQKSLEKKHGGLRHQK 228 + A R ++ +KTI+ ++ N +E M +LEK++ GL H+K Sbjct: 556 EAEVAELQRAADRHKADIDRREKTISDLRSANDQLEERMDGYRAENDALEKRNAGLEHEK 615 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -2 Query: 461 TRSSAISQKSVDVI-VH-PESSNNPLYRSKLAPVRSSSETQPGKKTITLRKTKNSSIEST 288 T S+A + DV +H PES++ R L SSS + K ++ + SS S Sbjct: 109 TASTAAADDVADVSDIHTPESTSGVQQRPLLLKKSSSSSSGVSKSSVNSSMYQASSSSSP 168 Query: 287 MSLPNQKSLEKKHGGLRH 234 SL S E +H L H Sbjct: 169 TSLSTLSSPETRHYHLPH 186 >SB_49823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 556 Score = 29.9 bits (64), Expect = 1.8 Identities = 26/110 (23%), Positives = 47/110 (42%), Gaps = 6/110 (5%) Frame = -2 Query: 458 RSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGKKTITLRKTKNSSIESTMSL 279 R S+ SQ+S + P+ L R++ ++S G L + +N +E +L Sbjct: 76 RPSSKSQESTQSVTQPKVRR--LDRAQKEVIQSFEGVSLGSLGKKLSRLENEQLERRQAL 133 Query: 278 ------PNQKSLEKKHGGLRHQKAVGAQSDITLTTQTSITDDRKALREAL 147 P +++ HQK +S I ++ Q +T ++A EAL Sbjct: 134 HAEGRKPPVNRAKERRSSTAHQKRRSRRSSIAMSKQKRMTRAQRARMEAL 183 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 29.9 bits (64), Expect = 1.8 Identities = 40/178 (22%), Positives = 75/178 (42%), Gaps = 15/178 (8%) Frame = -2 Query: 524 QALPKDDMIQKAEPTTSQRTLTRSSAISQKSVD---VIVHPESSNNPLYRSKLAPVRSS- 357 Q LP D + + T +QR + + A + + D V P S +P SK+ V S Sbjct: 38 QELPPDHETEPEDSTNAQREPSETKANDRATKDQSLADVIPNSPLSPTIMSKITIVEDSE 97 Query: 356 ---SETQPG----KKTITLRKTKNSSIESTMSLP----NQKSLEKKHGGLRHQKAVGAQS 210 S T+ + T +N ++ ++P ++K LE +H +K + Sbjct: 98 NEVSTTEDDEVFVETTYNTTNAENQDKQTAATVPEDAKHEKHLESRHKEREKKKQIHNSG 157 Query: 209 DITLTTQTSITDDRKALREALYQGIFHRHRRTIFAVGSFLRMLRSKTSNYDSIRSDSD 36 + TQ + K ++E++ R+T+ VGS+ R + S +S++ D + Sbjct: 158 ENLAKTQIEVP---KEVKESI-----RNARKTL--VGSWQRDISRTPSPVESVKEDME 205 >SB_29638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/78 (26%), Positives = 35/78 (44%) Frame = -2 Query: 476 SQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGKKTITLRKTKNSSI 297 S RT R I + I H +++NN + + A V + + GKK TK + Sbjct: 79 SARTRERLQPIGADASHTITH-DTNNNVVKTTSDAKVSTRRNSSGGKKDSEKPTTKKTEP 137 Query: 296 ESTMSLPNQKSLEKKHGG 243 E++ + + + E HGG Sbjct: 138 ETSEASHDDSTNEGAHGG 155 >SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1260 Score = 29.5 bits (63), Expect = 2.4 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = -1 Query: 501 DPEGGADNVTKNADSIERHQPKVSGRYRSPRELEQSS-LQIEARAGQVVVRNPTGQEDDY 325 D +GG +K+ + R P+ R S E E S ++ E+ + PTG DD Sbjct: 291 DADGG---YSKHKKQLLR-DPRSRRRCHSDYETEDSDFMESESELSIDSLLRPTGLPDDL 346 Query: 324 FEENKKFVNRINDEPSKPE 268 +EE + F + + E E Sbjct: 347 YEEGESFADELEKEGDDEE 365 >SB_11346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1706 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/82 (24%), Positives = 33/82 (40%) Frame = -2 Query: 521 ALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQP 342 AL K M Q + T + + + ++S P+ + + L V S T P Sbjct: 833 ALSKGSMGQLSSGVTDPKEIATTPSVSSTVSSTTTQPKLGTSIHEKKTLGKVTVSGAT-P 891 Query: 341 GKKTITLRKTKNSSIESTMSLP 276 G K K + S ++T S+P Sbjct: 892 GSKAARASKPRTPSKQTTSSIP 913 >SB_54026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.4 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 1/80 (1%) Frame = -2 Query: 488 EPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKL-APVRSSSETQPGKKTITLRKT 312 +P T++ + S+ + Q + V P+SSN P ++ L A ++T ++++TL + Sbjct: 75 DPKTNESSKACSNKVDQSQIKVKSRPKSSNGPENKTLLSASGIQRTKTSLQRESVTLETS 134 Query: 311 KNSSIESTMSLPNQKSLEKK 252 + +S K LEKK Sbjct: 135 FTPGKVAILSC--SKELEKK 152 >SB_13658| Best HMM Match : MbeD_MobD (HMM E-Value=2.3) Length = 529 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = -1 Query: 471 KNADSIERHQPKVSGRYRSPRELEQSSLQIE-ARAGQVVVRNPTGQEDDYFEENKKFVNR 295 KN + H P + PR+ Q +Q + AR G++ + PTG+ +Y K R Sbjct: 152 KNRERESEHVPLTT--MSLPRQQHQFDIQRKLARLGEIHLPTPTGESYNYCGPGTKHNKR 209 Query: 294 IND-EPS 277 +N +PS Sbjct: 210 LNSTDPS 216 >SB_5235| Best HMM Match : DnaJ (HMM E-Value=3.4) Length = 185 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = -2 Query: 368 VRSSSETQ-PGKKTITLRKTKNSSIESTMSLPNQKSLEKKHGGLRHQKAVGAQSDITLTT 192 +R ++T P K+ +T+ SS +S + +QKS +K HQK+ + Sbjct: 42 IRQVNQTSAPDKRIRQAHQTRASSDKSIIRQEHQKSASEKRIRQAHQKSAPEKRIRQAHH 101 Query: 191 QTSITDDRKALRE 153 QT + D+ +R+ Sbjct: 102 QTRASSDKSIIRQ 114 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 28.7 bits (61), Expect = 4.2 Identities = 25/108 (23%), Positives = 41/108 (37%), Gaps = 2/108 (1%) Frame = -2 Query: 527 QQALPKDDMIQKA--EPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSS 354 +Q K D+ Q EP + +LT+ +Q+S V P + + S Sbjct: 1117 KQTQQKTDVQQATLQEPQRQEESLTKQVQETQQSQGQPVKQSEETAPKQTDE---EQQSL 1173 Query: 353 ETQPGKKTITLRKTKNSSIESTMSLPNQKSLEKKHGGLRHQKAVGAQS 210 E P K T + + ++ P Q +K H + Q+A QS Sbjct: 1174 ENPPQKNTKAIHVQETQQTQTLQETPKQPRKQKDHKQTKQQQAGKEQS 1221 >SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 344 Score = 28.7 bits (61), Expect = 4.2 Identities = 21/109 (19%), Positives = 43/109 (39%), Gaps = 1/109 (0%) Frame = -2 Query: 512 KDDMIQKAEPTTSQ-RTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGK 336 +D+ + + + + R + + S+ V I P+ + R + +TQP + Sbjct: 27 QDNQVSRPRQASGKPRQSSLKTKTSKPQVQEIRKPQDQDKQAARPRDTQAARPKDTQPAR 86 Query: 335 KTITLRKTKNSSIESTMSLPNQKSLEKKHGGLRHQKAVGAQSDITLTTQ 189 RK ++ + ++ P QKS + K R K ++ T Q Sbjct: 87 AGQATRKPQDQNKQAARPRPRQKSRKIKRQASRKTKRQASRKTNTSKRQ 135 >SB_57931| Best HMM Match : Vicilin_N (HMM E-Value=0.96) Length = 203 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -2 Query: 296 ESTMSLPNQ-KSLEKKHGGLRHQKAVGAQSDITLTTQTSITDDRKALRE 153 E L NQ KSL +KH L Q+ +G QS ++ Q T +R +RE Sbjct: 38 ERVRGLENQKKSLIEKH-DLTQQQLLGYQSQLSKRRQMLETSERDRIRE 85 >SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) Length = 566 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/70 (27%), Positives = 30/70 (42%) Frame = -2 Query: 512 KDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGKK 333 K ++++P Q S S+ S + K A ++SS+T+ +K Sbjct: 189 KTSKTKRSKPQDKQAERQASRKTSKPKDKQAARQASRKTSKPQEKQAARQASSKTKTSRK 248 Query: 332 TITLRKTKNS 303 T T RKTK S Sbjct: 249 TKTSRKTKTS 258 >SB_28246| Best HMM Match : M (HMM E-Value=0.0007) Length = 1121 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -2 Query: 296 ESTMSLPNQ-KSLEKKHGGLRHQKAVGAQSDITLTTQTSITDDRKALRE 153 E L NQ KSL +KH L Q+ +G QS ++ Q T +R +RE Sbjct: 38 ERVRGLENQKKSLIEKH-DLTQQQLLGYQSQLSKRRQMLETSERDRIRE 85 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/60 (21%), Positives = 26/60 (43%) Frame = -1 Query: 570 FIIEHKQNDRNRS*TAGVAQGRHDPEGGADNVTKNADSIERHQPKVSGRYRSPRELEQSS 391 F + K+ NR+ + H + + + D+ ++H+PK +PR Q+S Sbjct: 644 FAAKAKEAKENRAASTSSPTSSHSSQNSETVLAERPDTSQKHEPKEGASEETPRSPVQAS 703 >SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09) Length = 1472 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -2 Query: 491 AEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGKKTIT 324 AE + +T TRS + S + S +P+ +K P SSS +P + +T Sbjct: 682 AEARSENQTHTRSLSSSSSENSLSFKVTKSTSPITVTKATPAWSSSAWKPNRPPVT 737 >SB_1837| Best HMM Match : Big_4 (HMM E-Value=8.1) Length = 213 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = -2 Query: 332 TITLRKTKNSSIESTMSLPNQKSLEKKHGGLRHQKAVGAQSDITLTTQTSIT 177 TI +R N ++ T+ LPN + + KH Q V +T + ++T Sbjct: 14 TIEIRLVVNGNLVHTLVLPNLRVITSKHNTSSDQSPVRLACHVTQHVKRTVT 65 >SB_13326| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 356 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/88 (20%), Positives = 34/88 (38%) Frame = -2 Query: 539 IEAEQQALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRS 360 ++ + L +D +I K + T K + + + P+ N + R L + Sbjct: 81 LKGKLDQLERDGIIAKVDGPTDWVHNIVVVENKNKDLQMCLDPKDLNQAIRREDLPTYKD 140 Query: 359 SSETQPGKKTITLRKTKNSSIESTMSLP 276 GK+ T+ KNS ++ T P Sbjct: 141 MISLLRGKRYFTILDQKNSFLQCTFKTP 168 >SB_57676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = -1 Query: 486 ADNVTKNADSIERHQPKVSGRYRSPRELEQSSLQIEARAGQVVVRNPTGQED--DYFEEN 313 A K S++ H+PK R+P+ S+ +I ++++P E E+N Sbjct: 152 AAKTKKVRTSVKFHRPKTLSLRRNPKYPRTSAPRINKLDHYAIIKHPLTTESAMKKIEDN 211 Query: 312 KKFVNRINDEPSKPEV 265 V ++ +KP++ Sbjct: 212 NTLVFIVDVRANKPQI 227 >SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 420 RSPRELEQSSLQIEARAGQVVVRNPTGQED 331 R E EQS+ ++ AR G +VRNP +D Sbjct: 125 RVEEEFEQSAEKLRARYGVQLVRNPKEPDD 154 >SB_50721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1057 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 278 PNQKSLEK-KHGGLRHQKAVGAQSDITLTTQTSITDDRKA 162 P ++SL K H + Q SD+T QTS+ D +KA Sbjct: 257 PRKRSLNKGNHTEVSRQLKETEDSDLTRAIQTSLEDTKKA 296 >SB_45929| Best HMM Match : ANF_receptor (HMM E-Value=4.8e-24) Length = 1001 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/80 (21%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = -2 Query: 530 EQQALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSE 351 ++Q D+I +E T + + ++ +DV + ++NP ++S L+P R Sbjct: 900 DKQCQTDADLINSSE-TKHVVVINKEPKENRAPIDVTLVKTENHNPSFQSPLSPTRGKKP 958 Query: 350 TQPGKKTITLR-KTKNSSIE 294 + K + + KT+ +E Sbjct: 959 SVKKKGKVPKKDKTQEKEVE 978 >SB_33539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 345 TGQEDDYFEENKKFVNRINDEP 280 T QE++ FE+ K+ N +ND P Sbjct: 5 TFQEEEQFEDAKRLFNNLNDTP 26 >SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) Length = 1650 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = -1 Query: 483 DNVTKNADSIERHQPKV-SGRYRSPRELEQSSLQIEARAGQVVVRNPTGQEDDYFEENKK 307 DN TKNADS + V +G+ R ++E+ + ++ V ++ T +D F E K Sbjct: 1046 DNSTKNADSATKAADTVANGQRRGKTDMEEMTSHFVSKNFTVALQPVTTFQD--FNE-VK 1102 Query: 306 FVNRINDE 283 RIN+E Sbjct: 1103 VGGRINNE 1110 >SB_38914| Best HMM Match : BAH (HMM E-Value=1.3e-08) Length = 733 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/70 (24%), Positives = 32/70 (45%) Frame = -2 Query: 509 DDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSSETQPGKKT 330 DD ++ +S R ++ K D PE + + R + P RS+S+ K++ Sbjct: 502 DDAENNSDHVSSARPNRVRASTESKRADEETEPEDAPLVITRPRGRPSRSNSDLDLRKRS 561 Query: 329 ITLRKTKNSS 300 +T T +S+ Sbjct: 562 LTWSLTNSST 571 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 27.5 bits (58), Expect = 9.7 Identities = 30/134 (22%), Positives = 56/134 (41%), Gaps = 1/134 (0%) Frame = -2 Query: 533 AEQQALPKDDMIQKAEPTTSQRTLTRSSAISQKSVDVIVHPESSNNPLYRSKLAPVRSSS 354 AE++ K ++ +SQ T T + +K D + S+ PL SK + S Sbjct: 180 AEKKCARKINITPTCLKFSSQSTNTTGNKQHKKKKDK--GKDESSKPLKDSKKE--KKKS 235 Query: 353 ETQPGKKTITLRKTKNSSIESTMSLPNQKSLEKKHGGLRHQKAVGAQSDITLTTQTSITD 174 E+ G T ++S+ L S++ KH + Q ++ + ++T+ Sbjct: 236 ESTKGSSD---NSTCPGRVKSSKHLNKPPSIDTKHSNIETDGGKKRQKTLSEMFKQAVTE 292 Query: 173 DR-KALREALYQGI 135 DR K L A+ + + Sbjct: 293 DRPKMLASAITKAL 306 >SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) Length = 2128 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/63 (25%), Positives = 25/63 (39%) Frame = -2 Query: 422 IVHPESSNNPLYRSKLAPVRSSSETQPGKKTITLRKTKNSSIESTMSLPNQKSLEKKHGG 243 I PE P+ R + V S + +P + R+ S E P Q + ++ Sbjct: 1551 IPQPECEQEPVSRQQYVKVESVPQEEPRPRQDFSREDAIQSHEGPKEEPRQGTERRREPS 1610 Query: 242 LRH 234 LRH Sbjct: 1611 LRH 1613 >SB_5814| Best HMM Match : PKD (HMM E-Value=6.3e-10) Length = 460 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = -2 Query: 440 QKSVDVIVHP---ESSNNPLYRSKLAPVRSSSETQPGKKTITLRKTKNSSIESTMSLPNQ 270 Q S + +V P ++NNPLY +R+S T P + + + N ++ + + Q Sbjct: 207 QLSYEWLVQPMNGRNNNNPLYNIPPEALRTSQLTFPASEVVPNLEALNITLTVSKRMRQQ 266 Query: 269 KS 264 KS Sbjct: 267 KS 268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,342,087 Number of Sequences: 59808 Number of extensions: 340628 Number of successful extensions: 1201 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1194 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -